Great research starts with great data.

Learn More
More >
Patent Analysis of

Swarm immunization with envelopes from CH505

Updated Time 12 June 2019

Patent Registration Data

Publication Number

US10149902

Application Number

US15/126220

Application Date

19 March 2015

Publication Date

11 December 2018

Current Assignee

TRIAD NATIONAL SECURITY, LLC,DUKE UNIVERSITY

Original Assignee (Applicant)

DUKE UNIVERSITY,LOS ALAMOS NATIONAL SECURITY, LLC

International Classification

A61K39/21,A61K39/00,C07H21/04,A61K39/12,C07K14/005

Cooperative Classification

A61K39/21,A61K39/12,C07K14/005,C12N7/00,A61K2039/53

Inventor

HAYNES, BARTON F.,GAO, FENG,KORBER, BETTE T.,HRABER, PETER T.

Patent Images

This patent contains figures and images illustrating the invention and its embodiment.

US10149902 Swarm immunization envelopes 1 US10149902 Swarm immunization envelopes 2 US10149902 Swarm immunization envelopes 3
See all images <>

Abstract

In certain aspects the invention provides HIV-1 immunogens, including envelopes (CH505) and selections therefrom, and methods for swarm immunizations using combinations of HIV-1 envelopes.

Read more

Claims

1. A recombinant HIV-1 envelope protein wherein the recombinant HIV-1envelope protein is a HIV-1 gp160 M5 envelope protein comprising amino acids 30 through 846 of SEQ ID NO:307, a HIV-1 gp140 M5 envelope protein derived from a HIV-1 gp160 M5 envelope protein comprising amino acids 30 through 846 of SEQ ID NO:307, a HIV-1 gp145 M5 envelope protein comprising amino acids 30 through 694 of SEQ ID NO:469, a HIV-1 gp120d8 M5 envelope protein comprising amino acids 29through 486 of SEQ ID NO:322, or a HIV-1 gp120 M5 envelope protein comprising amino acid sequence MWVTVYYG followed immediately by amino acids 30 through 486 of SEQ ID NO:322.

2. The recombinant HIV-1 envelope protein according to claim 1, wherein the recombinant HIV-1 envelope protein is a HIV-1 gp120d8 M5 envelope protein comprising amino acids 29 through 486 of SEQ ID NO:322.

3. The recombinant HIV-1 envelope protein according to claim 1, wherein the recombinant HIV-1 envelope protein is a HIV-1 gp120 M5 envelope protein comprising amino acid sequence MWVTVYYG followed immediately by amino acids 30 through 486 of SEQ ID NO:322.

4. The recombinant HIV-1 envelope protein according to claim 1, wherein the recombinant HIV-1 envelope protein is a HIV-1 gp140 M5 envelope protein derived from a HIV-1 gp160 M5 envelope protein comprising amino acids 30 through 846 of SEQ ID NO:307.

5. The recombinant HIV-1 envelope protein according to claim 1, wherein the recombinant HIV-1 envelope protein is a HIV-1 gp145 M5 envelope protein comprising amino acids 30 through 694 of SEQ ID NO:469.

6. The recombinant HIV-1 envelope protein according to claim 1, wherein the recombinant HIV-1 envelope protein is a HIV-1 gp160 M5 envelope protein comprising amino acids 30 through 846 of SEQ ID NO:307.

7. A nucleic acid comprising a nucleotide sequence encoding any one of the HIV-1 envelope proteins according to claim 1.

8. A vector comprising the nucleic acid according to claim 7, wherein the nucleic acid is operably linked to a promoter.

9. A composition comprising any one of the recombinant HIV-1 envelope proteins according to claim 1, and an adjuvant.

10. A composition comprising said nucleic acid according to claim 7 and an adjuvant.

11. A composition comprising said vector according to claim 8 and an adjuvant.

12. A method of inducing an immune response to HIV-1 comprising administering a composition comprising any one of the recombinant HIV-1 envelope proteins according claim 1, to a subject in an amount sufficient to effect said induction.

13. The method of claim 12, wherein the composition comprises an adjuvant.

14. A method of inducing an immune response to HIV-1 comprising administering a composition comprising said nucleic acid according to claim 7 to a subject in an amount sufficient to effect said induction.

15. The method of claim 14, wherein the composition comprises an adjuvant.

16. A method of inducing an immune response to HIV-1 comprising administering a composition comprising

a. said vector according to claim 8; and b. an adjuvant to a subject in an amount sufficient to effect said induction.

17. The method of claim 15, wherein the composition is administered as a prime in a prime boost regimen.

18. The method of claim 17, wherein a composition comprising at least one additional HIV-1 envelope protein from Table 14 or any combination thereof is administered as a boost in a prime boost regimen.

19. The method of claim 16, wherein the composition is administered as a prime in a prime boost regimen.

20. The method of claim 19, wherein a composition comprising at least one additional HIV-1 envelope protein from Table 14 or any combination thereof is administered as a boost in a prime boost regimen.

Read more

Claim Tree

  • 1
    1. A recombinant HIV-1 envelope protein wherein
    • the recombinant HIV-1envelope protein is a HIV-1 gp160 M5 envelope protein comprising
    • 2. The recombinant HIV-1 envelope protein according to claim 1, wherein
      • the recombinant HIV-1 envelope protein is a HIV-1 gp120d8 M5 envelope protein comprising
    • 3. The recombinant HIV-1 envelope protein according to claim 1, wherein
      • the recombinant HIV-1 envelope protein is a HIV-1 gp120 M5 envelope protein comprising
    • 4. The recombinant HIV-1 envelope protein according to claim 1, wherein
      • the recombinant HIV-1 envelope protein is a HIV-1 gp140 M5 envelope protein derived from a HIV-1 gp160 M5 envelope protein comprising
    • 5. The recombinant HIV-1 envelope protein according to claim 1, wherein
      • the recombinant HIV-1 envelope protein is a HIV-1 gp145 M5 envelope protein comprising
    • 6. The recombinant HIV-1 envelope protein according to claim 1, wherein
      • the recombinant HIV-1 envelope protein is a HIV-1 gp160 M5 envelope protein comprising
  • 7
    7. A nucleic acid comprising
    • a nucleotide sequence encoding any one of the HIV-1 envelope proteins according to claim 1.
  • 8
    8. A vector comprising
    • the nucleic acid according to claim 7, wherein the nucleic acid is operably linked to a promoter.
  • 9
    9. A composition comprising
    • any one of the recombinant HIV-1 envelope proteins according to claim 1, and an adjuvant.
  • 10
    10. A composition comprising
    • said nucleic acid according to claim 7 and an adjuvant.
  • 11
    11. A composition comprising
    • said vector according to claim 8 and an adjuvant.
  • 12
    12. A method of inducing an immune response to HIV-1 comprising
    • administering a composition comprising any one of the recombinant HIV-1 envelope proteins according claim 1, to a subject in an amount sufficient to effect said induction.
    • 13. The method of claim 12, wherein
      • the composition comprises
  • 14
    14. A method of inducing an immune response to HIV-1 comprising
    • administering a composition comprising said nucleic acid according to claim 7 to a subject in an amount sufficient to effect said induction.
    • 15. The method of claim 14, wherein
      • the composition comprises
  • 16
    16. A method of inducing an immune response to HIV-1 comprising
    • administering a composition comprising a. said vector according to claim 8
    • and b. an adjuvant to a subject in an amount sufficient to effect said induction.
    • 19. The method of claim 16, wherein
      • the composition is administered as a prime in a prime boost regimen.
See all independent claims <>

Description

SEQUENCE LISTING

The instant application contains a Sequence Listing which has been filed electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Jul. 2, 2018, is named 12343001300238US113 SL.txt and is 3,006,767 bytes in size.

TECHNICAL FIELD

The present invention relates in general, to a composition suitable for use in inducing anti-HIV-1 antibodies, and, in particular, to immunogenic compositions comprising envelope proteins and nucleic acids to induce cross-reactive neutralizing antibodies and increase their breadth of coverage. The invention also relates to methods of inducing such broadly neutralizing anti-HIV-1 antibodies using such compositions.

BACKGROUND

The development of a safe and effective HIV-1 vaccine is one of the highest priorities of the scientific community working on the HIV-1 epidemic. While anti-retroviral treatment (ART) has dramatically prolonged the lives of HIV-1 infected patients, ART is not routinely available in developing countries.

SUMMARY OF THE INVENTION

In certain embodiments, the invention provides compositions and method for induction of immune response, for example cross-reactive (broadly) neutralizing Ab induction. In certain embodiments, the methods use compositions comprising “swarms” of sequentially evolved envelope viruses that occur in the setting of bnAb generation in vivo in HIV-1 infection.

In certain aspects the invention provides compositions comprising a selection of HIV-1 envelopes or nucleic acids encoding these envelopes as described herein for example but not limited to Selections as described herein,. In certain embodiments, these compositions are used in immunization methods as a prime and/or boost as described in Selections as described herein.

In one aspect the invention provides selections of envelopes from individual CH505, which selections can be used in compositions for immunizations to induce lineages of broad neutralizing antibodies. In certain embodiments, there is some variance in the immunization regimen; in some embodiments, the selection of HIV-1 envelopes may be grouped in various combinations of primes and boosts, either as nucleic acids, proteins, or combinations thereof. In certain embodiments the compositions are pharmaceutical compositions which are immunogenic.

In one aspect the invention provides a composition comprising any one of the envelopes described herein, or any combination thereof (Tables 13, and 14, selections A-L). In some embodiments, CH505 transmitted/founder (T/F) Env is administered first as a prime, followed by a mixture of a next group of Envs, followed by a mixture of a next group of Envs, followed by a mixture of the final Envs. In some embodiments, grouping of the envelopes is based on their binding affinity for the antibodies expected to be induced. In some embodiments, grouping of the envelopes is based on chronological evolution of envelope viruses that occurs in the setting of bnAb generation in vivo in HIV-1 infection. In Loop D mutants could be included in either prime and/or boost. In some embodiments, the composition comprises an adjuvant. In some embodiments, the composition and methods comprise use of agents for transient modulation of the host immune response.

In one aspect the invention provides a composition comprising nucleic acids encoding HIV-1 envelope w000.T/F (or w004.03) and a loop D mutant, e.g. M11 or any other suitable D loop mutant or combination thereof. In some embodiments, the compositions and methods of the invention comprise use of any one of the mutant in FIG. 30, e.g., M14 and/or M24. A composition comprising nucleic acids encoding HIV-1 envelope w000.T/F (or w004.03), M11, w014.32, and w014.12. A composition comprising nucleic acids encoding HIV-1 envelope T/F (or w004.03), M11, w030.28, w053.16, w053.31, w078.7, w078.15, w078.33, w100.A4, and w100.B6.

In one aspect the invention provides a composition comprising nucleic acids encoding HIV-1 envelope w000.T/F (or w004.03), M11, w014.32, w014.12, w030.28, w053.16, w053.31, w078.7, w078.15, w078.33, w100.A4, and w100.B6.

In one aspect the invention provides a composition comprising nucleic acids encoding HIV-1 envelope w000.TF, w004.03, M10, M11, M19, M20, M21, M5, M6, M7, M8, and M9. A composition comprising nucleic acids encoding HIV-1 envelope w000.TF, w004.03, w004.26, M10, M11, M19, M20, M21, M5, M6, M7, M8, and M9. A composition comprising nucleic acids encoding HIV-1 envelope w014.10, w014.2, w014.21, w014.3, w014.32, w014.8, w020.3, w020.4, w020.7, w020.8, w020.9, w020.11, w020.13, w020.14, w020.15, w020.19, w020.22, w020.23, w020.24, and w020.26. A composition comprising nucleic acids encoding HIV-1 envelope w030.5, w030.6, w030.9, w030.10, w030.11, w030.13, w030.15, w030.17, w030.18, w030.19, w030.20, w030.21, w030.23, w030.25, w030.27, w030.28, and w030.36. A composition comprising nucleic acids encoding HIV-1 envelope w053.3, w053.6, w053.13, w053.16, w053.25, w053.29, w053.31, w078.1, w078.6, w078.7, w078.9, w078.10, w078.15, w078.17, w078.25, w078.33, and w078.38. A composition comprising nucleic acids encoding w100.A3, w100.A4, w100.A6, w100.A10, w100.Al2, w100.A13, w100.B2, w100.B4, w100.B6, w100.B7, w100.C7, w136.B2, w136.B3, w136.B4, w136.B5, w136.B8, w136.B10, w136.B12, w136.B18, w136.B20, w136.B27, w136.B29, w136.B36, w160.A1, w160.C1, w160.C2, w160.C4, w160.C11, w160.C12, w160.C14, w160.D1, w160.D5, w160.T2, and w160.T4.

In another aspect the invention provides a method of inducing an immune response in a subject comprising administering a composition comprising HIV-1 envelope T/F (or w004.03), and M11 as a prime in an amount sufficient to induce an immune response, wherein the envelope is administered as a polypeptide or a nucleic acid encoding the same. A method of inducing an immune response in a subject comprising administering a composition comprising HIV-1 envelope T/F (or w004.03), M11, w014.32, and w014.12 as a prime in an amount sufficient to induce an immune response, wherein the envelope is administered as a polypeptide or a nucleic acid encoding the same.

In certain embodiments the methods further comprise administering a composition comprising any one of HIV-1 envelope w030.28, w053.16, w053.31, w078.7, w078.15, w078.33, w100.A4, or w100.B6, or any combination thereof as a boost, wherein the envelope is administered as a polypeptide or a nucleic acid encoding the same.

In certain embodiments the methods further comprise administering a composition comprising any one of HIV-1 envelope w014.32, w014.12, w030.28, w053.16, w053.31, w078.7, w078.15, w078.33, w100.A4, or w100.B6, or any combination thereof as a boost, wherein the envelope is administered as a polypeptide or a nucleic acid encoding the same.

In another aspect the invention provides a method of inducing an immune response in a subject comprising administering a composition comprising HIV-1 envelope w000.TF, w004.03, w004.26, M10, Ml 1, M19, M20, M21, M5, M6, M7, M8, and M9 as a prime in an amount sufficient to induce an immune response, wherein the envelope is administered as a polypeptide or a nucleic acid encoding the same.

In certain embodiments the methods further comprise administering a composition comprising any one of HIV-1 envelope w014.10, w014.2, w014.21, w014.3, w014.32, w014.8, w020.3, w020.4, w020.7, w020.8, w020.9, w020.11, w020.13, w020.14, w020.15, w020.19, w020.22, w020.23, w020.24, or w020.26, or any combination thereof as a boost, wherein the envelope is administered as a polypeptide or a nucleic acid encoding the same.

In certain embodiments the methods further comprise administering a composition comprising any one of HIV-1 envelope w030.5, w030.6, w030.9, w030.10, w030.11, w030.13, w030.15, w030.17, w030.18, w030.19, w030.20, w030.21, w030.23, w030.25, w030.27, w030.28, or w030.36, or any combination thereof as a boost, wherein the envelope is administered as a polypeptide or a nucleic acid encoding the same.

In certain embodiments the methods further comprise administering a composition comprising any one of HIV-1 envelope w053.3, w053.6, w053.13, w053.16, w053.25, w053.29, w053.31, w078.1, w078.6, w078.7, w078.9, w078.10, w078.15, w078.17, w078.25, w078.33, or w078.38, or any combination thereof as a boost, wherein the envelope is administered as a polypeptide or a nucleic acid encoding the same.

In certain embodiments the methods further comprise administering a composition comprising any one of HIV-1 envelope w100.A3, w100.A4, w100.A6, w100.A10, w100.Al2, w100.A13, w100.B2, w100.B4, w100.B6, w100.B7, w100.C7, w136.B2, w136.B3, w136.B4, w136.B5, w136.B8, w136.B10, w136.B12, w136.B18, w136.B20, w136.B27, w136.B29, w136.B36, w160.A1, w160.C1, w160.C2, w160.C4, w160.C11, w160.C12, w160.C14, w160.D1, w160.D5, w160.T2, or w160.T4, or any combination thereof as a boost, wherein the envelope is administered as a polypeptide or a nucleic acid encoding the same.

In certain embodiments, the compositions contemplate nucleic acid, as DNA and/or RNA, or proteins immunogens either alone or in any combination. In certain embodiments, the methods contemplate genetic, as DNA and/or RNA, immunization either alone or in combination with envelope protein(s).

In certain embodiments the nucleic acid encoding an envelope is operably linked to a promoter inserted an expression vector. In certain aspects the compositions comprise a suitable carrier. In certain aspects the compositions comprise a suitable adjuvant.

In certain embodiments the induced immune response includes induction of antibodies, including but not limited to autologous and/or cross-reactive (broadly) neutralizing antibodies against HIV-1 envelope. Various assays that analyze whether an immunogenic composition induces an immune response, and the type of antibodies induced are known in the art and are also described herein.

In certain aspects the invention provides an expression vector comprising any of the nucleic acid sequences of the invention, wherein the nucleic acid is operably linked to a promoter. In certain aspects the invention provides an expression vector comprising a nucleic acid sequence encoding any of the polypeptides of the invention, wherein the nucleic acid is operably linked to a promoter. In certain embodiments, the nucleic acids are codon optimized for expression in a mammalian cell, in vivo or in vitro. In certain aspects the invention provides nucleic acid comprising any one of the nucleic acid sequences of invention. A nucleic acid consisting essentially of any one of the nucleic acid sequences of invention. A nucleic acid consisting of any one of the nucleic acid sequences of invention. In certain embodiments the nucleic acid of invention, is operably linked to a promoter and is inserted in an expression vector. In certain aspects the invention provides an immunogenic composition comprising the expression vector.

In certain aspects the invention provides a composition comprising at least one of the nucleic acid sequences of the invention. In certain aspects the invention provides a composition comprising any one of the nucleic acid sequences of invention. In certain aspects the invention provides a composition comprising at least one nucleic acid sequence encoding any one of the polypeptides of the invention.

In certain aspects the invention provides a composition comprising at least one nucleic acid encoding HIV-1 envelope T/F, w004.03, M11, w030.28, w053.16, w053.31, w078.7, w078.15, w078.33, w100.A4, and w100.B6 or any combination thereof.

In certain aspects the invention provides a composition comprising at least one nucleic acid encoding HIV-1 envelope T/F, w004.03, M11, w014.32, w014.12, w030.28, w053.16, w053.31, w078.7, w078.15, w078.33, w100.A4, and w100.B6, or any combination thereof.

In certain aspects the invention provides a composition comprising at least one nucleic acid encoding HIV-1 envelope w000.TF, w004.03, w004.26, M10, M11, M19, M20, M21, M5, M6, M7, M8, M9, w014.10, w014.2, w014.21, w014.3, w014.32, w014.8, w020.3, w020.4, w020.7, w020.8, w020.9, w020.11, w020.13, w020.14, w020.15, w020.19, w020.22, w020.23, w020.24, w020.26, w030.5, w030.6, w030.9, w030.10, w030.11, w030.13, w030.15, w030.17, w030.18, w030.19, w030.20, w030.21, w030.23, w030.25, w030.27, w030.28, w030.36, w053.3, w053.6, w053.13, w053.16, w053.25, w053.29, w053.31, w078.1, w078.6, w078.7, w078.9, w078.10, w078.15, w078.17, w078.25, w078.33, w078.38, w100.A3, w100.A4, w100.A6, w100.A10, w100.A12, w100.A13, w100.B2, w100.B4, w100.B6, w100.B7, w100.C7, w136.B2, w136.B3, w136.B4, w136.B5, w136.B8, w136.B10, w136.B12, w136.B18, w136.B20, w136.B27, w136.B29, w136.B36, w160.A1, w160.C1, w160.C2, w160.C4, w160.C11, w160.C12, w160.C14, w160.D1, w160.D5, w160.T2, and w160.T4, or any combination thereof.

In certain embodiments, the compositions and methods employ an HIV-1 envelope as polypeptide instead of a nucleic acid sequence encoding the HIV-1 envelope. In certain embodiments, the compositions and methods employ an HIV-1 envelope as polypeptide, a nucleic acid sequence encoding the HIV-1 envelope, or a combination thereof

The envelope used in the compositions and methods of the invention can be a gp160, gp150, gp145, gp140, gp120, gp41, N-terminal deletion variants as described herein, cleavage resistant variants as described herein, or codon optimized sequences thereof.

The polypeptide contemplated by the invention can be a polypeptide comprising any one of the polypeptides described herein. The polypeptide contemplated by the invention can be a polypeptide consisting essentially of any one of the polypeptides described herein. The polypeptide contemplated by the invention can be a polypeptide consisting of any one of the polypeptides described herein. In certain embodiments, the polypeptide is recombinantly produced. In certain embodiments, the polypeptides and nucleic acids of the invention are suitable for use as an immunogen, for example to be administered in a human subject.

BRIEF DESCRIPTION OF THE DRAWINGS

FIGS. 1A-C show CH505 Env polymorphisms, neutralization, vaccine regimes, and phylogeny.

FIG. 2 shows swarm vaccine variant frequencies in concatenated Env “hot-spot” sites, numbered as in Table 1. These sites were used to identify immunogens because they include polymorphisms resulting from immune selection by neutralizing antibodies. Three criteria identified Env sites of outstanding interest (“hot spots”) for antibody evolution: (a) “selected” sites with T/F frequency below 20% in any time-point sampled, (b) single or PNG sites with q<0.1 for tree-corrected signatures of neutralization activity, and (c) CD4 binding-site and known CH103 contacts with any variation. We extracted these sites from aligned sequences and concatenated them to see how each candidate clone varies in Env “hot spots” (Table 1). Rather than eliminate sites found by multiple methods, duplicate sites are included multiple times, for emphasis.

FIG. 3 shows one embodiment of alignment columns in Env “hot-spot” summaries, concatenated to comprise concatamers.

FIG. 4 shows another embodiment of alignment columns in Env “hot-spot” concatamer summaries.

FIG. 5 shows one embodiment of selected Envs as concatenated sites.

FIG. 6 shows another embodiment of selected Envs as concatenated sites.

FIG. 7 shows one embodiment of a proposed swarm of CH505 envelopes.

FIG. 8 shows another embodiment of a proposed swarm of CH505 envelopes.

FIG. 9 shows temporal development of CH505 variant frequencies for 36 Env sites from time of infection (Y0) through three years of follow-up (Y3), resulting from development of neutralizing antibody responses with increasing heterologous neutralization breadth. An O indicates a potentially N-(asparagine) linked glycosylation site. For clarity, only variants that exceed 20% frequency in any given sample are shown.

FIG. 10 shows temporal progression of CH505 variant frequencies for 40 Env sites from time of infection with the Transmitted/Founder virus (w000) through three years of follow-up (w160). Height of each character indicates its frequency per sample. In all except the top row, the Transmitted/Founder virus is not shown and constitutes the remaining portion of the sample. Insertions or deletions (indels) appear as grey blocks. Multiple sites with the same HXB2 numbering correspond to un-numbered insertions towards the C-terminal end of the position numbered.

FIG. 11 shows hierarchical clustering of CH505 variant frequencies per longitudinal sample (x-axis) for 26 selected CH505 Env mutations. Frequency of non-Transmitted/Founder mutations is proportional to the grey-scale value in each cell, and cells clustered together on the vertical axis indicate Env sites that vary in a concerted manner (i.e. in the same temporal window), rather than independently. Where a numbered site appears more than once (e.g., 359/V281G and 359/ V281 S), it depicts alternative non-Transmitted/Founder variant forms. Sites with indels and variant forms that fail to exceed 25% frequency of any given sample were excluded for clarity.

FIG. 12 shows hierarchical clustering of Shannon entropies per longitudinal sample (x-axis) for 40 selected CH505 Env sites. Low entropy means high prevalence of a single variant, whether Transmitted/Founder or an escape mutation, and high entropy indicates high variability. This uses the same information as FIGS. 9-11 but shows when and where variation is most active, clustering together on the vertical axis sites that share variability (entropy) profiles.

FIGS. 13A-C show an enlarged version of FIGS. 1A-C. FIGS. 1A-C show the genotype variation (A, left panel), neutralization titers (B, center panel), and Envelope phylogenetic relations (C, right panel) among CH505 Envelope variants. The vertical position in each panel corresponds to the same CH505 Env clone named on the right side of the tree. Distance from the Transmitted/Founder form generally increases from top towards bottom of the figure. In the left panel (A), sites not colored correspond to the Transmitted/Founder virus, red sites show mutations, and black sites correspond to insertions or deletions relative to the Transmitted/Founder virus. Additional annotation indicates the known CD4 binding-site contacts (short, vertical black bars towards top), CH103 binding-site contacts for the resolved structure (short, vertical blue bars with a horizontal line to indicate the region resolved by X-Ray Crystallography), gp120 landmarks (vertical grey rectangular regions, V1-V5 hypervariable loops, Loop D, and CD4 Loops), a dashed vertical line delineating the gp120/gp41 boundary, and results from testing for CTL epitopes with ELISpot assays (magenta bands at top and bottom show where peptides were tested and negative, and a magenta rectangle for the tested positive region outside the C-terminal end of V4). The center panel (B) depicts IC50 (50% inhibitory concentrations, in μg/ml) values from autologous neutralization assays against 13 monoclonal antibodies (MAbs) of the CH103 lineage and each of 134 CH505 Env-pseudotyped viruses. Color-scale values indicate neutralization potency and range from grey (no neutralization detected) through dark red (potent neutralization, i.e. <0.2 μg/ml; empty cells correspond to absence of information). The cumulative progression of neutralization potency from left to right, corresponding to developmental stages in the CH103 lineage, indicates accumulation of neutralization potency. Similarly, increased presence neutralization signal from top to bottom corresponds to increasing neutralization breadth per MAb in the CH103 lineage. In the right-most panel (C) is the phylogeny of CH505 Envs, with the x-axis indicating distance from the Transmitted-Founder virus per the scale bar (units are mutations per site). The tree is ordered vertically such that lineages with the most descendants appear towards the bottom. Each leaf on the tree corresponds to a CH505 autologous Env, with the name of the sequence depicted (‘w’ and symbol color indicate the sample time-point; ‘M’i ndicates a synthetic mutant Env). The color of text in each leaf name indicates its inclusion in a possible embodiment, or grey for exclusion from any embodiments described herein. Three long, vertical lines to the left of the tree depict the phylogenetic distribution of envelopes in three distinct alternative embodiments (identified as “Vaccination Regimes 1-3”), with diamonds used to identify each.

FIG. 14A shows nucleic acid sequence of T/F virus from individual CH505 (SEQ ID NO: 1)FIG. 14B shows CH505 HIV-1 gene sequences (SEQ ID NOS 2-10, respectively, in order of appearance).

FIG. 15 shows nucleic acid sequences (gp160) of CH505 envelopes (SEQ ID NOS 11-112, respectively, in order of appearance).

FIG. 16 shows nucleic acid sequences encoding gp120D CH505 envelopes (SEQ ID NOS 113-215, respectively, in order of appearance).

FIG. 17 shows amino acid sequences (gp160) of CH505envelopes (SEQ ID NOS 216-321, respectively, in order of appearance). “Z” at the end of the sequence indicates a stop codon.

FIG. 18 shows amino acid sequences (gp120D8) of CH505 envelopes (SEQ ID NOS 322-424, respectively, in order of appearance).

FIG. 19A shows one embodiment of a swarm of CH505 envelopes (SEQ ID NOS 425-437, respectively, in order of appearance). FIG. 19B shows the complete sequences of the envelopes of FIG. 19A (SEQ ID NOS 425-437, respectively, in order of appearance). FIG. 19C shows one embodiment of a swarm of CH505 envelopes (SEQ ID NOS 438-449, respectively, in order of appearance).

FIG. 20 shows amino acid sequences (gp145) of CH505 envelopes (SEQ ID NOS 450-553, respectively, in order of appearance).

FIG. 21 shows nucleic acid sequences encoding gp145 CH505 envelopes (SEQ ID NOS 554-657, respectively, in order of appearance).

FIG. 22 shows “The HIV-1 Arms Race” as a graphical representation of mapping the Virus and Antibody from the Time of Transmission.

FIG. 23shows isolation of broad neutralizing antibodies from chronically Infected Individual CH0505 Followed From Time of Transmission

FIG. 24 shows tempo and site of accumulation of mutations at the contact sites between virus and CH103 mAb.

FIG. 25 shows an assay for identification of CD4 Binding Site broad neutralizing lineage antibodies. VRC01 and CH103 CD4Binding Site BnAbs do not bind RSCdelta371 (D371). For plasma, a greater than 2.5 fold loss of binding when the titer is over 200 suggests the presence of CD4bs BnAb (Lynch, JVI, 2012).

FIG. 26 shows FACS analysis identifying CH505 TF gp120 Reactive Memory B Cells that Demonstrate RSC3 Binding Reactivity (Gr. 1, animal 5346 in NHP study #79). FACS analysis is carried out essentially as described in Example 1. FIG. 26A shows CH505 TF gp120 DP=109; RSC3-positive (black DP)=10 (9%). FIG. 26B shows CH505 TF gp120 DP=110; RSC3-positive (black DP)=8 (7%).

FIG. 27 shows RSC3+, RSC3D371-Memory B Cells in CH505 T/F Env-Immunized #79 NHPs. FACS analysis is carried out essentially as described in Example 1.

FIG. 28 shows induction of autologous neutralization of both the transmitted/founder CH505 Env and neutralization sensitive CH505 Env variant w004.3 in NHPs. Shown is week 14 neutralization data from TZMb1 assay after three immunizations.

FIG. 29 is a heatmap showing neutralization potency of antibodies in the CH103 lineage against early CH505 mutations, evaluated by Feng Gao. M11 shows enhanced sensitivity relative to the TF, so might serve as a good trigger of the CH103 like lineage.

FIG. 30 shows a heatmap showing neutralization potency of antibodies in the CH103 lineage against population signature mutations. M14 confers partial resistance on its own, while the others need to be given in combination to confer resistance. In certain embodiments, adding M14 and M24 after affinity maturation is initiated may expand breadth.

FIG. 31 shows sequences of trivalent envelope mosaics (SEQ ID NOS 658-663, respectively, in order of appearance).

DETAILED DESCRIPTION OF THE INVENTION

The development of a safe, highly efficacious prophylactic HIV-1 vaccine is of paramount importance for the control and prevention of HIV-1 infection. A major goal of HIV-1 vaccine development is the induction of broadly neutralizing antibodies (bnAbs) (Immunol. Rev. 254: 225-244, 2013). BnAbs are protective in rhesus macaques against SHIV challenge, but as yet, are not induced by current vaccines.

For the past 25 years, the HIV vaccine development field has used single or prime boost heterologous Envs as immunogens, but to date has not found a regimen to induce high levels of bnAbs.

Recently, a new paradigm for design of strategies for induction of broadly neutralizing antibodies was introduced, that of B cell lineage immunogen design (Nature Biotech. 30: 423, 2012) in which the induction of bnAb lineages is recreated. It was recently demonstrated the power of mapping the co-evolution of bnAbs and founder virus for elucidating the Env evolution pathways that lead to bnAb induction (Nature 496: 469, 2013). From this type of work has come the hypothesis that bnAb induction will require a selection of antigens to recreate the “swarms” of sequentially evolved viruses that occur in the setting of bnAb generation in vivo in HIV infection (Nature 496: 469, 2013).

A critical question is why the CH505 immunogens are better than other immunogens. This rationale comes from three recent observations. First, a series of immunizations of single putatively “optimized” or “native” trimers when used as an immunogen have not induced bnAbs as single immunogens. Second, in all the chronically infected individuals who do develop bnAbs, they develop them in plasma after ˜2 years. When these individuals have been studied at the time soon after transmission, they do not make bnAbs immediately. Third, now that individual's virus and bnAb co-evolution has been mapped from the time of transmission to the development of bnAbs, the identification of the specific Envs that lead to bnAb development have been identified-thus taking the guess work out of env choice.

Two other considerations are important. The first is that for the CH103 bnAb CD4 binding site lineage, the VH4-59 and Vλ3-1 genes are common as are the VDJ, VJ recombinations of the lineage (Liao, Nature 496: 469, 2013). In addition, the bnAb sites are so unusual, we are finding that the same VH and VL usage is recurring in multiple individuals. Thus, we can expect the CH505 Envs to induce CD4 binding site antibodies in many different individuals.

Finally, regarding the choice of gp120 vs. gp160, for the genetic immunization we would normally not even consider not using gp160. However, in acute infection, gp41 non-neutralizing antibodies are dominant and overwhelm gp120 responses (Tomaras, G et al. J. Virol. 82: 12449, 2008; Liao, H X et al. JEM 208: 2237, 2011). Recently we have found that the HVTN 505 DNA prime, rAd5 vaccine trial that utilized gp140 as an immunogen, also had the dominant response of non-neutralizing gp41 antibodies. Thus, we will evaluate early on the use of gp160 vs gp120 for gp41 dominance.

In certain aspects the invention provides a strategy for induction of bnAbs is to select and develop immunogens designed to recreate the antigenic evolution of Envs that occur when bnAbs do develop in the context of infection. Therefore, we believe that the groups of CH505 Envs proposed in this study is the “best in class” of current Env immunogens.

That broadly neutralizing antibodies (bnAbs) occur in nearly all sera from chronically infected HIV-1 subjects suggests anyone can develop some bnAb response if exposed to immunogens via vaccination. Working back from mature bnAbs through intermediates enabled understanding their development from the unmutated ancestor, and showed that antigenic diversity preceded the development of population breadth. See Liao et al. (2013) Nature 496, 469-476. In this study, an individual “CH505” was followed from HIV-1 transmission to development of broadly neutralizing antibodies. This individual developed antibodies targeted to CD4 binding site on gp120. In this individual the virus was sequenced over time, and broadly neutralizing antibody clonal lineage (“CH103”) was isolated by antigen-specific B cell sorts, memory B cell culture, and amplified by VH/VL next generation pyrosequencing. The CH103 lineage began by binding the T/F virus, autologous neutralization evolved through somatic mutation and affinity maturation, escape from neutralization drove rapid (clearly by 20 weeks) accumulation of variation in the epitope, antibody breadth followed this viral diversification (FIG. 22-23).

Further analysis of envelopes and antibodies from the CH505 individual indicated that a non-CH103 Lineage participates in driving CH103-BnAb induction. For example V1 loop, V5 loop and CD4 binding site loop mutations escape from CH103 and are driven by CH103 lineage. Loop D mutations enhanced neutralization by CH103 lineage and are driven by another lineage. Transmitted/founder Env, or another early envelope for example W004.26, triggers naïve B cell with CH103 Unmutated Common Ancestor (UCA) which develop in to intermediate antibodies. Transmitted/founder Env, or another early envelope for example W004.26, also triggers non-CH103 autologous neutralizing Abs that drive loop D mutations in Env that have enhanced binding to intermediate and mature CH103 antibodies and drive remainder of the lineage. In certain embodiments, the inventive composition and methods also comprise loop D mutant envelopes (e.g. but not limited to M10, M11, M19, M20, M21, M5, M6, M7, M8, M9) as immunogens. In certain embodiments, the D-loop mutants are included in a composition used as a prime.

The invention provides various methods to choose a subset of viral variants, including but not limited to envelopes, to investigate the role of antigenic diversity in serial samples. In other aspects, the invention provides compositions comprising viral variants, for example but not limited to envelopes, selected based on various criteria as described herein to be used as immunogens. In some embodiments, the immunogens are selected based on the envelope binding to the UCA, and/or intermediate antibodies. In other embodiments the immunogens are selected based on their chronological appearance during infection.

In other aspects, the invention provides immunization strategies using the selections of immunogens to induce cross-reactive neutralizing antibodies. In certain aspects, the immunization strategies as described herein are referred to as “swarm” immunizations to reflect that multiple envelopes are used to induce immune responses. The multiple envelopes in a swarm could be combined in various immunization protocols of priming and boosting.

In certain embodiments the invention provides that sites losing the ancestral, transmitted-founder (T/F) state are most likely under positive selection. From acute, homogenous infections with 3-5 years of follow-up, identified herein are sites of interest among plasma single genome analysis (SGA) Envs by comparing the proportion of sequences per time-point in the T/F state with a threshold, typically 5%. Sites with T/F frequencies below threshold are putative escapes. We then selected clones with representative escape mutations. Where more information was available, such as tree-corrected neutralization signatures and antibody contacts from co-crystal structure, additional sites of interest were considered.

Co-evolution of a broadly neutralizing HIV-1 antibody (CH103) and founder virus was previously reported in African donor (CH505). See Liao et al. (2013) Nature 496, 469-476. In CH505, which had an early antibody that bound autologous T/F virus, we studied 398 envs from 14 time-points over three years (median per sample: 25, range: 18-53). We found 36 sites with T/F frequencies under 20% in any sample. Neutralization and structure data identified 28 and 22 interesting sites, respectively. Together, six gp41 and 53 gp120 sites were identified, plus six V1 or V5 insertions not in HXB2.

The invention provides an approach to select reagents for neutralization assays and subsequently investigate affinity maturation, autologous neutralization, and the transition to heterologous neutralization and breadth. Given the sustained coevolution of immunity and escape this antigen selection based on antibody and antigen coevolution has specific implications for selection of immunogens for vaccine design.

In one embodiment, 100 clones were selected that represent the selected sites. In another embodiment, 101 clones were selected that represent the selected sites. In another embodiment, 103 clones were selected that represent the selected sites. In another embodiment, 104 clones were selected that represent the selected sites. one embodiment, 10 clones were selected that represent the selected sites. In one embodiment, 12 clones were selected that represent the selected sites. In one embodiment, 4 clones were selected that represent the selected sites. These sets of clones represent antigenic diversity by deliberate inclusion of polymorphisms that result from immune selection by neutralizing antibodies, and had a lower clustering coefficient and greater diversity in selected sites than sets sampled randomly. These selections of clones represent various levels of antigenic diversity in the HIV-1 envelope and are based on the genetic diversity of longitudinally sampled SGA envelopes, and correlated with other factors such as antigenic/neutralization diversity, and antibody coevolution.

Sequences/clones

Described herein are nucleic and amino acids sequences of HIV-1 envelopes. In certain embodiments, the described HIV-1 envelope sequences are gp160s. In certain embodiments, the described HIV-1 envelope sequences are gp120s. Other sequences, for example but not limited to gp145s, gp140s, both cleaved and uncleaved, gp150s, gp41s, which are readily derived from the nucleic acid and amino acid gp160 sequences. In certain embodiments the nucleic acid sequences are codon optimized for optimal expression in a host cell, for example a mammalian cell, a rBCG cell or any other suitable expression system.

In certain embodiments, the envelope design in accordance with the present invention involves deletion of residues (e.g., 5-11, 5, 6, 7, 8, 9, 10, or 11 amino acids) at the N-terminus. For delta N-terminal design, amino acid residues ranging from 4 residues or even fewer to 14 residues or even more are deleted. These residues are between the maturation (signal peptide, usually ending with CX, X can be any amino acid) and “VPVXXXX . . . ”. In case of CH505 T/F Env as an example, 8 amino acids (italicized and underlined in the below sequence) were deleted: MRVMGIQRNYPQWWIWSMLGFWMLMICNGMWVTVTVYYGVPVWKEAKTTLFCASDAKAYE KEVHNVWATHACVPTDPNPQE (SEQ ID NO: 664) . . . (rest of envelope sequence is indicated as “. . . ”). In other embodiments, the delta N-design described for CH505 T/F envelope can be used to make delta N-designs of other CH505 envelopes. In certain embodiments, the invention relates generally to an immunogen, gp160, gp120 or gp140, without an N-terminal Herpes Simplex gD tag substituted for amino acids of the N-terminus of gp120, with an HIV leader sequence (or other leader sequence), and without the original about 4 to about 25, for example 11, amino acids of the N-terminus of the envelope (e.g. gp120). See W02013/006688, e.g. at pages 10-12, the contents of which publication is hereby incorporated by reference in its entirety.

The general strategy of deletion of N-terminal amino acids of envelopes results in proteins, for example gp120s, expressed in mammalian cells that are primarily monomeric, as opposed to dimeric, and, therefore, solves the production and scalability problem of commercial gp120 Env vaccine production. In other embodiments, the amino acid deletions at the N-terminus result in increased immunogenicity of the envelopes.

In certain embodiments, the invention provides envelope sequences, amino acid sequences and the corresponding nucleic acids, and in which the V3 loop is substituted with the following V3loop sequence TRPNNNTRKSIRIGPGQTFY ATGDIIGNIRQAH (SEQ ID NO: 665). This substitution of the V3 loop reduced product cleavage and improves protein yield during recombinant protein production in CHO cells.

In certain embodiments, the CH505 envelopes will have added certain amino acids to enhance binding of various broad neutralizing antibodies. Such modifications could include but not limited to, mutations at W680G or modification of glycan sites for enhanced neutralization.

In certain aspects, the invention provides composition and methods which use a selection of sequential CH505 Envs, as gp120s, gp 140s cleaved and uncleaved, gp145s, gp150s and gp160s, as proteins, DNAs, RNAs, or any combination thereof, administered as primes and boosts to elicit immune response. Sequential CH505 Envs as proteins would be co-administered with nucleic acid vectors containing Envs to amplify antibody induction. In a non-limiting embodiment the CH505 Envs include transmitted/founder, week 53, week 58, week 100 envelopes. In certain embodiments, the compositions and methods include any immunogenic HIV-1 sequences to give the best coverage for T cell help and cytotoxic T cell induction. In certain embodiments, the compositions and methods include mosaic and/or consensus HIV-1 genes to give the best coverage for T cell help and cytotoxic T cell induction. In certain embodiments, the compositions and methods include mosaic group M and/or consensus genes to give the best coverage for T cell help and cytotoxic T cell induction. In some embodiments, the mosaic genes are any suitable gene from the HIV-1 genome. In some embodiments, the mosaic genes are Env genes, Gag genes, Pol genes, Nef genes, or any combination thereof. See e.g. U.S. Pat. No. 7,951,377. In some embodiments the mosaic genes are bivalent mosaics. In some embodiments the mosaic genes are trivalent. In some embodiments, the mosaic genes are administered in a suitable vector with each immunization with Env gene inserts in a suitable vector and/or as a protein. In some embodiments, the mosaic genes, for example as bivalent mosaic Gag group M consensus genes, are administered in a suitable vector, for example but not limited to HSV2, would be administered with each immunization with Env gene inserts in a suitable vector, for example but not limited to HSV-2.

In certain aspects the invention provides compositions and methods of Env genetic immunization either alone or with Env proteins to recreate the swarms of evolved viruses that have led to bnAb induction. Nucleotide-based vaccines offer a flexible vector format to immunize against virtually any protein antigen. Currently, two types of genetic vaccination are available for testing—DNAs and mRNAs.

In certain aspects the invention contemplates using immunogenic compositions wherein immunogens are delivered as DNA. See Graham B S, Enama M E, Nason M C, Gordon I J, Peel S A, et al. (2013) DNA Vaccine Delivered by a Needle-Free Injection Device Improves Potency of Priming for Antibody and CD8+ T-Cell Responses after rAd5 Boost in a Randomized Clinical Trial. PLoS ONE 8(4): e59340, page 9. Various technologies for delivery of nucleic acids, as DNA and/or RNA, so as to elicit immune response, both T-cell and humoral responses, are known in the art and are under developments. In certain embodiments, DNA can be delivered as naked DNA. In certain embodiments, DNA is formulated for delivery by a gene gun. In certain embodiments, DNA is administered by electroporation, or by a needle-free injection technologies, for example but not limited to Biojector® device. In certain embodiments, the DNA is inserted in vectors. The DNA is delivered using a suitable vector for expression in mammalian cells. In certain embodiments the nucleic acids encoding the envelopes are optimized for expression. In certain embodiments DNA is optimized, e.g. codon optimized, for expression. In certain embodiments the nucleic acids are optimized for expression in vectors and/or in mammalian cells. In non-limiting embodiments these are bacterially derived vectors, adenovirus based vectors, rAdenovirus (e.g. Barouch D H, et al. Nature Med. 16: 319-23, 2010), recombinant mycobacteria (e.g. rBCG or M smegmatis) (Yu, J S et al. Clinical Vaccine Immunol. 14: 886-093, 2007; ibid 13: 1204-11, 2006), and recombinant vaccinia type of vectors (Santra S. Nature Med. 16: 324-8, 2010), for example but not limited to ALVAC, replicating (Kibler K V et al., PLoS One 6: e25674, 2011 Nov. 9.) and non-replicating (Perreau M et al. J. virology 85: 9854-62, 2011) NYVAC, modified vaccinia Ankara (MVA)), adeno-associated virus, Venezuelan equine encephalitis (VEE) replicons, Herpes Simplex Virus vectors, and other suitable vectors.

In certain aspects the invention contemplates using immunogenic compositions wherein immunogens are delivered as DNA or RNA in suitable formulations. Various technologies which contemplate using DNA or RNA, or may use complexes of nucleic acid molecules and other entities to be used in immunization. In certain embodiments, DNA or RNA is administered as nanoparticles consisting of low dose antigen-encoding DNA formulated with a block copolymer (amphiphilic block copolymer 704). See Cany et al., Journal of Hepatology 2011 vol. 54 j 115-121; Arnaoty et al., Chapter 17 in Yves Bigot (ed.), Mobile Genetic Elements: Protocols and Genomic Applications, Methods in Molecular Biology, vol. 859, pp293-305 (2012); Arnaoty et al. (2013) Mol Genet Genomics. 2013 Aug;288(7-8):347-63. Nanocarrier technologies called Nanotaxi® for immunogenic macromolecules (DNA, RNA, Protein) delivery are under development. See for example technologies developed by incellart.

In certain aspects the invention contemplates using immunogenic compositions wherein immunogens are delivered as recombinant proteins. Various methods for production and purification of recombinant proteins suitable for use in immunization are known in the art.

The immunogenic envelopes can also be administered as a protein boost in combination with a variety of nucleic acid envelope primes (e.g., HIV-1 Envs delivered as DNA expressed in viral or bacterial vectors).

Dosing of proteins and nucleic acids can be readily determined by a skilled artisan. A single dose of nucleic acid can range from a few nanograms (ng) to a few micrograms GO or milligram of a single immunogenic nucleic acid. Recombinant protein dose can range from a few μg micrograms to a few hundred micrograms, or milligrams of a single immunogenic polypeptide.

Administration: The compositions can be formulated with appropriate carriers using known techniques to yield compositions suitable for various routes of administration. In certain embodiments the compositions are delivered via intramascular (IM), via subcutaneous, via intravenous, via nasal, via mucosal routes, or any other suitable route of immunization.

The compositions can be formulated with appropriate carriers and adjuvants using techniques to yield compositions suitable for immunization. The compositions can include an adjuvant, such as, for example but not limited to, alum, poly IC, MF-59 or other squalene-based adjuvant, ASOIB, or other liposomal based adjuvant suitable for protein or nucleic acid immunization. In certain embodiments, TLR agonists are used as adjuvants. In other embodiment, adjuvants which break immune tolerance are included in the immunogenic compositions.

In certain embodiments, the methods and compositions comprise any suitable agent or immune modulation which could modulate mechanisms of host immune tolerance and release of the induced antibodies. In non-limiting embodiments modulation includes PD-1 blockade; T regulatory cell depletion; CD40L hyperstimulation; soluble antigen administration, wherein the soluble antigen is designed such that the soluble agent eliminates B cells targeting dominant epitopes, or a combination thereof. In certain embodiments, an immunomodulatory agent is administered in at time and in an amount sufficient for transient modulation of the subject's immune response so as to induce an immune response which comprises broad neutralizing antibodies against HIV-1 envelope. Non-limiting examples of such agents is any one of the agents described herein: e.g. chloroquine (CQ), PTP1B Inhibitor-CAS 765317-72-4-Calbiochem or MSI 1436 clodronate or any other bisphosphonate; a Foxol inhibitor, e.g. 344355 |Foxo1 Inhibitor, AS1842856—Calbiochem; Gleevac, anti-CD25 antibody, anti-CCR4 Ab, an agent which binds to a B cell receptor for a dominant HIV-1 envelope epitope, or any combination thereof. In certain embodiments, the methods comprise administering a second immunomodulatory agent, wherein the second and first immunomodulatory agents are different.

There are various host mechanisms that control bNAbs. For example highly somatically mutated antibodies become autoreactive and/or less fit (Immunity 8: 751, 1998; PloS Comp. Biol. 6 e1000800, 2010; J. Thoret. Biol. 164:37, 1993); Polyreactive/autoreactive naïve B cell receptors (unmutated common ancestors of clonal lineages) can lead to deletion of Ab precursors (Nature 373: 252, 1995; PNAS 107: 181, 2010; J. Immunol. 187: 3785, 2011); Abs with long HCDR3 can be limited by tolerance deletion (JI 162: 6060, 1999; JCI 108: 879, 2001). BnAb knock-in mouse models are providing insights into the various mechanisms of tolerance control of MPER BnAb induction (deletion, anergy, receptor editing). Other variations of tolerance control likely will be operative in limiting BnAbs with long HCDR3s, high levels of somatic hypermutations. 2F5 and 4E10 BnAbs were induced in mature antibody knock-in mouse models with MPER peptide-liposome-TLR immunogens. Next step is immunization of germline mouse models and humans with the same immunogens.

The invention is described in the following non-limiting examples.


TABLE 13
Summary of nomenclature used to identify sequences
envelope
gp120
Plasmid ID#
gp145
Plasmid ID#
1.
CH505.M5
CH505.M5D8gp120
HV1300531_v2
CH505.M5gp145
HV1300656
2.
CH505.M6
CH505.M6D8gp120
HV1300532_v2
CH505.M6gp145
HV1300657
3.
CH505.M7
CH505.M7D8gp120
HV1300533_v2
CH505.M7gp145
HV1300658
4.
CH505.M8
CH505.M8D8gp120
HV1300534_v2
CH505.M8gp145
HV1300659
5.
CH505.M9
CH505.M9D8gp120
HV1300535_v2
CH505.M9gp145
HV1300660
6.
CH505.M10
CH505.M10D8gp120
HV1300536_v2
CH505.M10gp145
HV1300661
7.
CH505.M11
CH505.M11D8gp120
HV1300537_v2
CH505.M11gp145
HV1300662
8.
CH505.M19
CH505.M19D8gp120
HV1300538_v2
CH505.M19gp145
HV1300663
9.
CH505.M20
CH505.M20D8gp120
HV1300539_v2
CH505.M20gp145
HV1300664
10.
CH505.M21
CH505.M21D8gp120
HV1300540_v2
CH505.M21gp145
HV1300665
11.
CH505TF
CH505TFD8gp120
HV1300541_v2
CH505TFgp145
HV1300631
12.
CH505w004.03
CH505w004.03D8gp120
CH505w004.03gp145
HV1300632
13.
CH505w004.10
CH505w004.10D8gp120
HV1300542_v2
CH505w04.10gp145
HV1300666
14.
CH505w014.2
CH505w014.2D8gp120
HV1300543_v2
CH505w14.2gp145
HV1300667
15.
CH505w014.3
CH505w014.3D8gp120
HV1300544_v2
CH505w014.3gp145
HV1300641
16.
CH505w014.8
CH505w014.8D8gp120
HV1300545_v2
CH505w014.8gp145
HV1300642
17.
CH505w014.10
CH505w014.10D8gp120
HV1300546_v2
CH505w14.10gp145
HV1300668
18.
CH505w014.21
CH505w014.21D8gp120
HV1300547_v2
CH505w014.21gp145
HV1300634
19.
CH505w014.32
CH505w014.32D8gp120
HV1300548_v2
CH505w14.32gp145
HV1300669
20.
CH505w020.3
CH505w020.3D8gp120
HV1300549_v2
CH505w20.3gp145
HV1300670
21.
CH505w020.4
CH505w020.4D8gp120
HV1300550_v2
CH505w20.4gp145
HV1300671
22.
CH505w020.7
CH505w020.7D8gp120
HV1300551_v2
CH505w020.7gp145
HV1300643
23.
CH505w020.8
CH505w020.8D8gp120
HV1300552_v2
CH505w20.8gp145
HV1300672
24.
CH505w020.9
CH505w020.9D8gp120
HV1300553_v2
CH505w020.9gp145
HV1300645
25.
CH505w020.11
CH505w020.11D8gp120
HV1300554_v2
CH505w20.11gp145
HV1300673
26.
CH505w020.13
CH505w020.13D8gp120
HV1300555_v2
CH505w20.13gp145*
HV1300684
27.
CH505w020.14
CH505w020.14D8gp120
HV1300556_v2
CH505w020.14gp145
HV1300635
28.
CH505w020.15
CH505w020.15D8gp120
HV1300557_v2
CH505w20.15gp145
HV1300674
29.
CH505w020.19
CH505w020.19D8gp120
HV1300558_v2
CH505w20.19gp145
HV1300675
30.
CH505w020.22
CH505w020.22D8gp120
HV1300559_v2
CH505w20.22gp145
HV1300676
31.
CH505w020.23
CH505w020.23D8gp120
HV1300560_v2
CH505w20.23gp145
HV1300677
32.
CH505w020.24
CH505w020.24D8gp120
HV1300561_v2
CH505w20.24gp145
HV1300678
33.
CH505w020.26
CH505w020.26D8gp120
HV1300562_v2
CH505w020.26gp145
HV1300644
34.
CH505w030.5
CH505w030.5D8gp120
HV1300563_v2
CH505w30.5gp145
HV1300679
35.
CH505w030.6
CH505w030.6D8gp120
HV1300564_v2
CH505w30.6gp145
HV1300680
36.
CH505w030.9
CH505w030.9D8gp120
HV1300565_v2
CH505w30.9gp145
HV1300681
37.
CH505w030.10
CH505w030.10D8gp120
HV1300566_v2
CH505w30.10gp145
HV1300682
38.
CH505w030.11
CH505w030.11D8gp120
HV1300567_v2
CH505w30.11gp145
HV1300683
39.
CH505w030.13
CH505w030.13D8gp120
HV1300568_v2
CH505w030.13gp145
HV1300637
40.
CH505w030.15
CH505w030.15D8gp120
HV1300569_v2
CH505w30.15gp145
HV1300685
41.
CH505w030.17
CH505w030.17D8gp120
HV1300570_v2
CH505w30.17gp145
HV1300686
42.
CH505w030.18
CH505w030.18D8gp120
HV1300571_v2
CH505w30.18gp145
HV1300687
43.
CH505w030.19
CH505w030.19D8gp120
HV1300572_v2
CH505w030.19gp145
HV1300756
44.
CH505w030.20
CH505w030.20D8gp120
HV1300573_v2
CH505w30.20gp145
HV1300688
45.
CH505w030.21
CH505w030.21D8gp120
HV1300574_v2
CH505w30.21gp145
HV1300689
46.
CH505w030.23
CH505w030.23D8gp120
HV1300575_v2
CH505w30.23gp145
HV1300690
47.
CH505w030.25
CH505w030.25D8gp120
HV1300576_v2
CH505w30.25gp145
HV1300691
48.
CH505w030.27
CH505w030.27D8gp120
HV1300577_v2
CH505w30.27gp145
HV1300692
49.
CH505w030.28
CH505w030.28D8gp120
HV1300578_v2
CH505w030.28gp145
HV1300636
50.
CH505w030.36
CH505w030.36D8gp120
HV1300579_v2
CH505w30.36gp145
HV1300693
51.
CH505w053.3
CH505w053.3D8gp120
HV1300580_v2
CH505w53.3gp145
HV1300694
52.
CH505w053.6
CH505w053.6D8gp120
HV1300581
CH505w53.6gp145
HV1300695
53.
CH505w053.13
CH505w053.13D8gp120
HV1300582
CH505w053.13gp145
HV1300649
54.
CH505w053.16
CH505w053.16D8gp120
HV1300583
CH505w53.16gp145
HV1300696
55.
CH505w053.25
CH505w053.25D8gp120
HV1300584
CH505w53.25gp145
HV1300697
56.
CH505w053.29
CH505w053.29D8gp120
HV1300585
CH505w53.29gp145
HV1300698
57.
CH505w053.31
CH505w053.31D8gp120
HV1300586
CH505w053.31gp145
HV1300638
58.
CH505w078.1
CH505w078.1D8gp120
HV1300587
CH505w078.1gp145
HV1300650
59.
CH505w078.6
CH505w078.6D8gp120
HV1300588
CH505w78.6gp145
HV1300699
60.
CH505w078.7
CH505w078.7D8gp120
HV1300589
CH505w78.7gp145
HV1300700
61.
CH505w078.9
CH505w078.9D8gp120
HV1300590
CH505w78.9gp145
HV1300701
62.
CH505w078.10
CH505w078.10D8gp120
HV1300591
CH505w78.10gp145
HV1300702
63.
CH505w078.15
CH505w078.15D8gp120
HV1300592
CH505w078.15gp145
HV1300639
64.
CH505w078.17
CH505w078.17D8gp120
HV1300593
CH505w78.17gp145
HV1300703
65.
CH505w078.25
CH505w078.25D8gp120
HV1300594
CH505w78.25gp145
HV1300704
66.
CH505w078.33
CH505w078.33D8gp120
HV1300595
CH505w78.33gp145
HV1300705
67.
CH505w078.38
CH505w078.38D8gp120
HV1300596
CH505w78.38gp145
HV1300706
68.
CH505w100.A3
CH505w100.A3D8gp120
HV1300597
CH505w100.A3gp145
HV1300707
69.
CH505w100.A4
CH505w100.A4D8gp120
HV1300598
CH505w100.A4gp145
HV1300708
70.
CH505w100.A6
CH505w100.A6D8gp120
HV1300599
CH505w100.A6gp145
HV1300709
71.
CH505w100.A10
CH505w100.A10D8gp120
HV1300600
CH505w100.A10gp145
HV1300710
72.
CH505w100.A12
CH505w100.A12D8gp120
HV1300601
CH505w100.A12gp145
HV1300711
73.
CH505w100.A13
CH505w100.A13D8gp120
HV1300602
CH505w100.A13gp145
HV1300712
74.
CH505w100.B2
CH505w100.B2D8gp120
HV1300603
CH505w100.B2gp145
HV1300713
75.
CH505w100.B4
CH505w100.B4D8gp120
HV1300604
CH505w100.B4gp145
HV1300640
76.
CH505w100.B6
CH505w100.B6D8gp120
HV1300605
CH505w100.B6gp145
HV1300714
77.
CH505w100.B7
CH505w100.B7D8gp120
HV1300606
CH505w100.B7gp145
HV1300715
78.
CH505w100.C7
CH505w100.C7D8gp120
HV1300607
CH505w100.C7gp145
HV1300716
79.
CH505w136.B2
CH505w136.B2D8gp120
HV1300608
CH505w136.B2gp145
HV1300717
80.
CH505w136.B3
CH505w136.B3D8gp120
HV1300609
CH505w136.B3gp145
HV1300718
81.
CH505w136.B4
CH505w136.B4D8gp120
HV1300610
CH505w136.B4gp145
HV1300719
82.
CH505w136.B5
CH505w136.B5D8gp120
HV1300611
CH505w136.B5gp145
HV1300720
83.
CH505w136.B8
CH505w136.B8D8gp120
HV1300612
CH505w136.B8gp145
HV1300721
84.
CH505w136.B10
CH505w136.B10D8gp120
HV1300613
CH505w136.B10gp145
HV1300722
85.
CH505w136.B12
CH505w136.B12D8gp120
HV1300614
CH505w136.B12gp145
HV1300723
86.
CH505w136.B18
CH505w136.B18D8gp120
HV1300615
CH505w136.B18gp145
HV1300724
87.
CH505w136.B20
CH505w136.B20D8gp120
HV1300616
CH505w136.B20gp145
HV1300725
88.
CH505w136.B27
CH505w136.B27D8gp120
HV1300617
CH505w136.B27gp145
HV1300726
89.
CH505w136.B29
CH505w136.B29D8gp120
HV1300618
CH505w136.B29gp145
HV1300727
90.
CH505w136.B36
CH505w136.B36D8gp120
HV1300619
CH505w136.B36gp145
HV1300728
91.
CH505w160.A1
CH505w160.A1D8gp120
HV1300620
CH505w160.A1gp145
HV1300729
92.
CH505w160.C2
CH505w160.C2D8gp120
HV1300621
CH505w160.C2gp145
HV1300730
93.
CH505w160.C4
CH505w160.C4D8gp120
HV1300622
CH505w160.C4gp145
HV1300731
94.
CH505w160.C11
CH505w160.C11D8gp120
HV1300623
CH505w160.C11gp145
HV1300732
95.
CH505w160.C12
CH505w160.C12D8gp120
HV1300624
CH505w160.C12gp145
HV1300733
96.
CH505w160.C14
CH505w160.C14D8gp120
HV1300625
CH505w160.C14gp145
HV1300734
97.
CH505w160.D1
CH505w160.D1D8gp120
HV1300626
CH505w160.D1gp145
HV1300735
98.
CH505w160.D5
CH505w160.D5D8gp120
HV1300627
CH505w160.D5gp145
HV1300736
99.
CH505w160.T2
CH505w160.T2D8gp120
HV1300628
CH505w160.T2gp145
HV1300737
100.
CH505w160.T4
CH505w160.T4D8gp120
HV1300629
CH505w160.T4gp145
HV1300738
101.
CH505.w4.26
CH505.w4.26D8gp120
HV1300777
CH505.w4.26gp145
HV1300633
102.
CH505.w30.12
CH505.w30.12D8gp120
HV1300778
CH505.w30.12gp145
HV1300646
103.
CH505.w53.19
CH505.w53.19D8gp120
HV1300779
CH505.w53.19gp145
HV1300648
104.
CH05w020.2.
CH05w020.2.D8gp120
HV1300749
CH505w020.2.gp145
HV1300748
#identified both the nucleic acid (FIG. 16, and 21) and amino acid sequences (FIGS. 18 20).


TABLE 14
shows a summary of sequence names and sequence identifiers.
Gp120 aa
Gp160 aa
Gp160 nt
Gp145 aa
Gp145 nt
D8
Gp120D nt
Name
SEQ ID NO
SEQ ID NO
SEQ ID NO
SEQ ID NO
SEQ ID NO
SEQ ID NO
1.
CH505.M5
307
102
469
573
322
113
2.
CH505.M6
316
111
470
574
323
114
3.
CH505.M7
312
107
471
575
324
115
4.
CH505.M8
314
109
472
576
325
116
5.
CH505.M9
311
106
473
577
326
117
6.
CH505.M10
309
104
474
578
327
118
7.
CH505.M11
310
105
475
579
328
119
8.
CH505.M19
308
103
476
580
329
120
9.
CH505.M20
313
108
477
581
330
121
10.
CH505.M21
315
110
478
582
331
122
11.
CH505TF
216
11
450
554
 332*
 123*
12.
CH505w004.03
217
12
451
555
 332*
 123*
13.
CH505w004.10
219
14
479
583
333
124
14.
CH505w014.2
222
17
480
584
334
125
15.
CH505w014.3
220
15
460
564
335
126
16.
CH505w014.8
225
20
461
565
336
127
17.
CH505w014.10
224
19
481
585
337
128
18.
CH505w014.21
223
18
453
557
338
129
19.
CH505w014.32
221
16
482
586
339
130
20.
CH505w020.3
239
34
483
587
340
131
21.
CH505w020.4
229
24
484
588
341
132
22.
CH505w020.7
227
22
462
566
342
133
23.
CH505w020.8
230
25
485
589
343
134
24.
CH505w020.9
236
31
464
568
344
135
25.
CH505w020.11
233
28
486
590
345
136
26.
CH505w020.13
238
33
497
600
346
137
27.
CH505w020.14
231
26
454
558
347
138
28.
CH505w020.15
232
27
487
591
348
139
29.
CH505w020.19
237
32
488
592
349
140
30.
CH505w020.22
226
21
489
593
350
141
31.
CH505w020.23
234
29
490
594
351
142
32.
CH505w020.24
235
30
491
595
352
143
33.
CH505w020.26
228
23
463
567
353
144
34.
CH505w030.5
249
44
492
666
354
145
35.
CH505w030.6
243
38
493
596
355
146
36.
CH505w030.9
247
42
494
597
356
147
37 .
CH505w030.10
253
48
495
598
357
148
38.
CH505w030.11
240
35
496
599
358
149
39.
CH505w030.13
255
50
456
560
359
150
40.
CH505w030.15
252
47
498
601
360
151
41.
CH505w030.17
242
37
499
602
361
152
42.
CH505w030.18
246
41
500
603
362
153
43.
CH505w030.19
256
51
553
656
363
154
44.
CH505w030.20
241
36
501
604
364
155
45.
CH505w030.21
245
40
502
605
365
156
46.
CH505w030.23
251
46
503
606
366
157
47.
CH505w030.25
244
39
504
607
367
158
48.
CH505w030.27
250
45
505
608
368
159
49.
CH505w030.28
254
49
455
559
369
160
50.
CH505w030.36
248
43
506
609
370
161
51.
CH505w053.3
257
52
507
610
371
162
52.
CH505w053.6
259
54
508
611
372
163
53.
CH505w053.13
263
58
467
571
373
164
54.
CH505w053.16
262
57
509
612
374
165
55.
CH505w053.25
260
55
510
613
375
166
56.
CH505w053.29
258
53
511
614
376
167
57.
CH505w053.31
261
56
457
561
377
168
58.
CH505w078.1
269
64
468
572
378
169
59.
CH505w078.6
264
59
512
615
379
170
60.
CH505w078.7
273
68
513
616
380
171
61.
CH505w078.9
266
61
514
617
381
172
62.
CH505w078.10
271
66
515
618
382
173
63.
CH505w078.15
270
65
458
562
383
174
64.
CH505w078.17
268
63
516
619
384
175
65.
CH505w078.25
265
60
517
620
385
176
66.
CH505w078.33
267
62
518
621
386
177
67.
CH505w078.38
272
67
519
622
387
178
68.
CH505w100.A3
278
73
520
623
388
179
69.
CH505w100.A4
276
71
521
624
389
180
70.
CH505w100.A6
274
69
522
625
390
181
71.
CH505w100.A10
277
72
523
626
391
182
72.
CH505w100.A12
275
70
524
627
392
183
73.
CH505w100.A13
284
79
525
628
393
184
74.
CH505w100.B2
279
74
526
629
394
185
75.
CH505w100.B4
280
75
459
563
395
186
76.
CH505w100.B6
283
78
527
630
396
187
77.
CH505w100.B7
282
77
528
631
397
188
78.
CH505w100.C7
281
76
529
632
398
189
70.
CH505w136.B2
294
89
530
633
399
190
80.
CH505w136.B3
295
90
531
634
400
191
81.
CH505w136.B4
288
83
532
635
401
192
82.
CH505w136.B5
293
88
533
636
402
193
81
CH505w136.B8
290
85
534
637
403
194
84.
CH505w136.B10
285
80
535
638
404
195
85.
CH505w136.B12
287
82
536
639
405
196
86.
CH505w136.B18
296
91
537
640
406
197
87.
CH505w136.B20
292
87
538
641
407
198
88.
CH505w136.B27
286
81
539
642
408
199
80.
CH505w136.B29
289
84
540
643
409
200
90.
CH505w136.B36
291
86
541
644
410
201
91.
CH505w160.A1
297
92
542
645
411
202
92.
CH505w160.C2
301
96
543
646
412
203
93.
CH505w160.C4
302
97
544
647
413
204
94.
CH505w160.C11
298
93
545
648
414
205
95.
CH505w160.C12
299
94
546
649
415
206
96.
CH505w160.C14
300
95
547
650
416
207
97.
CH505w160.D1
303
98
548
651
417
208
98.
CH505w160.D5
304
99
549
652
418
209
99.
CH505w160.T2
305
100
550
653
419
210
100.
CH505w160.T4
306
101
551
654
420
211
101.
CH505.w4.26
318
13
452
556
422
213
102.
CH505.w30.12
319
423
214
103.
CH505.w53.19
320
424
215
104.
CH05w020.2
321
655
421
212
Other sequences
CH505 virus
 1
CH505 viral
  2;
genes: Gag, Pol,
  3;
Vif, Vpr, Tat,
  4;
Rev, VPU, Env,
  5;
Nef, respectively
  6;
  7;
  8;
  9;
 10
*The gp120 aa and nt sequence for TF and w004.3 envelope is the same.

EXAMPLES

Example 1

HIV-1 sequences, including envelopes, and antibodies from HIV-1 infected individual CH505 were isolated as described in Liao et al. (2013) Nature 496, 469-476 including supplementary materials.

Recombinant HIV-1 Proteins

HIV-1 Env genes for subtype B, 63521, subtype C, 1086, and subtype CRF_01, 427299, as well as subtype C, CH505 autologous transmitted/founder Env were obtained from acutely infected HIV-1 subjects by single genome amplification, codon-optimized by using the codon usage of highly expressed human housekeeping genes, de novo synthesized (GeneScript) as gp140 or gp120 (AE.427299) and cloned into a mammalian expression plasmid pcDNA3.1/hygromycin (Invitrogen). Recombinant Env glycoproteins were produced in 293F cells cultured in serum-free medium and transfected with the HIV-1 gp140- or gp120-expressing pcDNA3.1 plasmids, purified from the supernatants of transfected 293F cells by using Galanthus nivalis lectin-agarose (Vector Labs) column chromatography, and stored at −80 ° C. Select Env proteins made as CH505 transmitted/founder Env were further purified by superose 6 column chromatography to trimeric forms, and used in binding assays that showed similar results as with the lectin-purified oligomers.

ELISA

Binding of patient plasma antibodies and CH103 clonal lineage antibodies to autologous and heterologous HIV-1 Env proteins was measured by ELISA as described previously. Plasma samples in serial threefold dilutions starting at 1:30 to 1:521,4470 or purified monoclonal antibodies in serial threefold dilutions starting at 100 μg ml−1 to 0.000 μg ml−1 diluted in PBS were assayed for binding to autologous and heterologous HIV-1 Env proteins. Binding of biotin-labelled CH103 at the subsaturating concentration was assayed for cross-competition by unlabelled HIV-1 antibodies and soluble CD4-Ig in serial fourfold dilutions starting at 10 μg ml−1. The half-maximal effective concentration (EC50) of plasma samples and monoclonal antibodies to HIV-1 Env proteins were determined and expressed as either the reciprocal dilution of the plasma samples or concentration of monoclonal antibodies.

Surface plasmon resonance affinity and kinetics measurements

Binding Kd and rate constant (association rate (Ka)) measurements of monoclonal antibodies and all candidate UCAs to the autologous Env C. CH05 gp140 and/or the heterologous Env B.63521 gp120 were carried out on BIAcore 3000 instruments as described previously. Anti-human IgG Fc antibody (Sigma Chemicals) was immobilized on a CM5 sensor chip to about 15,000 response units and each antibody was captured to about 50-200 response units on three individual flow cells for replicate analysis, in addition to having one flow cell captured with the control Synagis (anti-RSV) monoclonal antibody on the same sensor chip. Double referencing for each monoclonal antibody-HIV-1 Env binding interactions was used to subtract nonspecific binding and signal drift of the Env proteins to the control surface and blank buffer flow, respectively. Antibody capture level on the sensor surface was optimized for each monoclonal antibody to minimize rebinding and any associated avidity effects. C.CH505 Env gp140 protein was injected at concentrations ranging from 2 to 25 μg ml−1, and B.63521 gp120 was injected at 50-400 μg ml−1 for UCAs and early intermediates IA8 and IA4, 10-100 μg ml−1 for intermediate IA3, and 1-25 μg ml−1 for the distal and mature monoclonal antibodies. All curve-fitting analyses were performed using global fit of to the 1:1 Langmuir model and are representative of at least three measurements. All data analysis was performed using the BIAevaluation 4.1 analysis software (GE Healthcare).

Neutralization assays

Neutralizing antibody assays in TZM-bl cells were performed as described previously. Neutralizing activity of plasma samples in eight serial threefold dilutions starting at 1:20 dilution and for recombinant monoclonal antibodies in eight serial threefold dilutions starting at 50 μg ml−1 were tested against autologous and herologous HIV-1 Env-pseudotyped viruses in TZM-bl-based neutralization assays using the methods known in the art. Neutralization breadth of CH103 was determined using a panel of 196 of geographically and genetically diverse Env-pseudoviruses representing the major circulated genetic subtypes and circulating recombinant forms. HIV-1 subtype robustness is derived from the analysis of HIV-1 clades over time. The data were calculated as a reduction in luminescence units compared with control wells, and reported as IC50 in either reciprocal dilution for plasma samples or in micrograms per microlitre for monoclonal antibodies.

The GenBank accession numbers for 292 CH505 Env proteins are KC247375-KC247667, and accessions for 459 VHDJH and 174 VLJL sequences of antibody members in the CH103 clonal lineage are KC575845-KC576303 and KC576304-KC576477, respectively.

Example 2

Combinations of antigens derived from CH505 envelope sequences for swarm Immunizations

Provided herein are non-limiting examples of combinations of antigens derived from CH505 envelope sequences for a swarm immunization. The selection includes priming with a virus which binds to the UCA, for example a T/F virus or another early (e.g. but not limited to week 004.3, or 004.26) virus envelope. In certain embodiments the prime could include D-loop variants. In certain embodiments the boost could include D-loop variants. In certain embodiments, these D-loop variants are envelope escape mutants not recognized by the UCA. Non-limiting examples of such D-loop variants are envelopes designated as M10, M11, M19, M20, M21, M5, M6, M7, M8, M9, M14 (TF13M14), M24 (TF1324), M15, M16, M17, M18, M22, M23, M24, M25, M26.

Non-limiting embodiments of envelopes selected for swarm vaccination are shown as the selections described below. A skilled artisan would appreciate that a vaccination protocol can include a sequential immunization starting with the “prime” envelope(s) and followed by sequential boosts, which include individual envelopes or combination of envelopes. In another vaccination protocol, the sequential immunization starts with the “prime” envelope(s) and is followed with boosts of cumulative prime and/or boost envelopes (for e.g. Table 5). In certain embodiments, the prime does not include T/F sequence (W000.TF). In certain embodiments, the prime includes w004.03 envelope. In certain embodiments, the prime includes w004.26 envelope. In certain embodiments, the immunization methods do not include immunization with HIV-1 envelope T/F. In other embodiments for example the T/F envelope may not be included when w004.03 or w004.26 envelope is included. In certain embodiments, the immunization methods do not include a schedule of four valent immunization with HIV-1 envelopes T/F, w053.16, w078.33, and w100.B6.

In certain embodiments, there is some variance in the immunization regimen; in some embodiments, the selection of HIV-1 envelopes may be grouped in various combinations of primes and boosts, either as nucleic acids, proteins, or combinations thereof.

In certain embodiments the immunization includes a prime administered as DNA, and MVA boosts. See Goepfert, et al. 2014; “Specificity and 6-Month Durability of Immune Responses Induced by DNA and Recombinant Modified Vaccinia Ankara Vaccines Expressing HIV-1 Virus-Like Particles” J Infect Dis. 2014 Feb. 9. [Epub ahead of print].

HIV-1 Envelope selection A (four envelopes): w004.03 (T/F or w004.03), w053.16, w078.33, and w100.B6.

  • 1: Prime: w004.03 (T/F or w004.03)
  • 2: Boost: w053.16,
  • 3: Boost: w078.33.
  • 4: Boost: w100.B6.

HIV-1 Envelope selection B (ten envelopes): w004.03 (T/F or w004.03), M11, w030.28, w053.16, w053.31, w078.7, w078.15, w078.33, w100.A4, w100.B6.

  • 1: Prime: w004.03 (T/F or w004.03), M11.
  • 2: Boost: w030.28.
  • 3: Boost: w053.16, w053.31, w078.7, w078.15, w078.33.
  • 4: Boost with: w100.A4, w100.B6.

HIV-1 Envelope selection C (twelve envelopes): w004.03 (T/F or w004.03), M11, w014.32, w014.12, w030.28, w053.16, w053.31, w078.7, w078.15, w078.33, w100.A4, w100.B6.

  • 1: Prime: w004.03 (T/F or w004.03), M11.
  • 2: Boost: w014.32, w014.12
  • 3: Boost: w030.28.
  • 4: Boost: w053.16, w053.31, w078.7, w078.15, w078.33.
  • 5: Boost with: w100.A4, w100.B6.

HIV-1 Envelope selection D (twelve envelopes): w004.03 (T/F or w004.03), M11, w014.32, w014.12, w030.28, w053.16, w053.31, w078.7, w078.15, w078.33, w100.A4, w100.B6.

  • 1: Prime: w004.03 (T/F or w004.03), M11; w014.32, w014.12
  • 2: Boost: w030.28.
  • 3: Boost: w053.16, w053.31, w078.7, w078.15, w078.33. 4: Boost with: w100.A4, w100.B6.

HIV-1 Envelope selection E (excludes # viruses from selections in Table 3 and 3A):

  • 1: Prime: w000.TF, w004.03, M10, M11, M19, M20, M21, M5, M7, M8, M9.
  • 2: Boost with: w014.10, w014.2, w014.21, w014.3, w014.32, w014.8 w020.3, w020.4, w020.7, w020.8, w020.9, w020.11, w020.13, w020.15, w020.19, w020.22, w020.23, w020.24, w020.26
  • 3: Boost with: w030.5, w030.6, w030.9, w030.10, w030.11, w030.13, w030.15, w030.17, w030.18, w030.19, w030.20, w030.21, w030.23, w030.25, w030.27, w030.28, w030.36
  • 4: Boost with: w053.3, w053.6, w053.13, w053.16, w053.25, w053.29, w053.31, w078.1, w078.6, w078.7, w078.9, w078.10, w078.15, w078.17, w078.33, w078.38
  • 5: Boost with: w100.A3, w100.A4, w100.A6, w100.A10, w100.Al2, w100.A13, w100.B2, w100.B6, w100.B7, w136.B2, w136.B3, w136.B4, w136.B5, w136.B8, w136.B10, w136.B12, w136.B18, w136.B20, w136.B27, w136.B29, w136.B36, w160.A1, w160.C1, w160.C2, w160.C4, w160.C11, w160.C12, w160.C14, w160.D1, w160.D5, w160.T2, w160.T4.

HIV-1 Envelope selection F (one hundred envelopes) (Table 3):

  • 1: Prime: w000.TF, w004.03, M10, M11, M19, M20, M21, M5, M6, M7, M8, M9.
  • 2: Boost: w014.10, w014.2, w014.21, w014.3, w014.32, w014.8 w020.3, w020.4, w020.7, w020.8, w020.9, w020.11, w020.13, w020.14, w020.15, w020.19, w020.22, w020.23, w020.24, w020.26
  • 3: Boost: w030.5, w030.6, w030.9, w030.10, w030.11, w030.13, w030.15, w030.17, w030.18, w030.19, w030.20, w030.21, w030.23, w030.25, w030.27, w030.28, w030.36
  • 4: Boost: w053.3, w053.6, w053.13, w053.16, w053.25, w053.29, w053.31, w078.1, w078.6, w078.7, w078.9, w078.10, w078.15, w078.17, w078.25, w078.33, w078.38
  • 5: Boost: w100.A3, w100.A4, w100.A6, w100.A10, w100.Al2, w100.A13, w100.B2, w100.B4, w100.B6, w100.B7, w100.C7, w136.B2, w136.B3, w136.B4, w136.B5, w136.B8, w136.B10, w136.B12, w136.B18, w136.B20, w136.B27, w136.B29, w136.B36, w160.A1, w160.C1, w160.C2, w160.C4, w160.C11, w160.C12, w160.C14, w160.D1, w160.D5, w160.T2, w160.T4.

HIV-1 Envelope selection G (101 envelopes) (Table 3A):

  • 1. Prime: w000.TF, w004.03, w004.26, M10, M11, M19, M20, M21, M5, M6, M7, M8, M9
  • 2. Boost: w014.10, w014.2, w014.21, w014.3, w014.32, w014.8, w020.3, w020.4, w020.7, w020.8, w020.9, w020.11, w020.13, w020.14, w020.15, w020.19, w020.22, w020.23, w020.24, w020.26
  • 3. Boost: w030.5, w030.6, w030.9, w030.10, w030.11, w030.13, w030.15, w030.17, w030.18, w030.19, w030.20, w030.21, w030.23, w030.25, w030.27, w030.28, w030.36
  • 4. Boost: w053.3, w053.6, w053.13, w053.16, w053.25, w053.29, w053.31, w078.1, w078.6, w078.7, w078.9, w078.10, w078.15, w078.17, w078.25, w078.33, w078.38
  • 5. Boost: w100.A3, w100.A4, w100.A6, w100.A10, w100.Al2, w100.A13, w100.B2, w100.B4, w100.B6, w100.B7, w100.C7, w136.B2, w136.B3, w136.B4, w136.B5, w136.B8, w136.B10, w136.B12, w136.B18, w136.B20, w136.B27, w136.B29, w136.B36, w160.A1, w160.C1, w160.C2, w160.C4, w160.C11, w160.C12, w160.C14, w160.D1, w160.D5, w160.T2, w160.T4.

HIV-1 envelope selection H (eight envelopes) M11, w004.03, w030.28, w053.16, w053.31, w078.15, w078.33, w100.B6

HIV-1 envelope selection I (ten envelopes) M11, M14, M24, w004.03, w030.28, w053.16, w053.31, w078.15, w078.33, w100.B6. in some embodiments M11+w004.03, then wk030.28+wk 078.15 then wk 053.31+wk 078.7, then w100 B6+w 100. A4 week 53.16, week 78.33; Alternatively they can be administered all together as a swarm in 4 or 5 prime and boosts with or without DNA accompanyments.

HIV-1 envelope selection J (twelve envelopes) M11, M14, M24, w004.03, w030.28, w053.16, w053.31, w078.07, w078.15, w078.33, w100.B6, w100.A4.

HIV-1 envelope selection K (ten envelopes) M11, w004.03, w030.28, w053.16, w053.31, w078.07, w078.15, w078.33, w100.B6, w100.A4).

HIV-1 envelope selection L (104 envelopes as gp160s, gp145s, gp140s; 103 envelopes as gp120D8s; See Tables 13 and 14): CH505.M5; CH505.M6; CH505.M7; CH505.M8; CH505.M9; CH505.M10; CH505.M11; CH505.M19; CH505.M20; CH505.M21; CH505TF; CH505w004.03; CH505w004.10; CH505w014.2; CH505w014.3; CH505w014.8; CH505w014.10; CH505w014.21; CH505w014.32; CH505w020.3; CH505w020.4; CH505w020.7; CH505w020.8; CH505w020.9; CH505w020.11; CH505w020.13; CH505w020.14; CH505w020.15; CH505w020.19; CH505w020.22; CH505w020.23; CH505w020.24; CH505w020.26; CH505w030.5; CH505w030.6; CH505w030.9; CH505w030.10; CH505w030.11; CH505w030.13; CH505w030.15; CH505w030.17; CH505w030.18; CH505w030.19; CH505w030.20; CH505w030.21; CH505w030.23; CH505w030.25; CH505w030.27; CH505w030.28; CH505w030.36; CH505w053.3; CH505w053.6; CH505w053.13; CH505w053.16; CH505w053.25; CH505w053.29; CH505w053.31; CH505w078.1; CH505w078.6; CH505w078.7; CH505w078.9; CH505w078.10; CH505w078.15; CH505w078.17; CH505w078.25; CH505w078.33; CH505w078.38; CH505w100.A3; CH505w100.A4; CH505w100.A6; CH505w100.A10; CH505w100.A12; CH505w100.A13; CH505w100.B2; CH505w100.B4; CH505w100.B6; CH505w100.B7; CH505w100.C7; CH505w136.B2; CH505w136.B3; CH505w136.B4; CH505w136.B5; CH505w136.B8; CH505w136.B10; CH505w136.B12; CH505w136.B18; CH505w136.B20; CH505w136.B27; CH505w136.B29; CH505w136.B36; CH505w160.A1; CH505w160.C2; CH505w160.C4; CH505w160.C11; CH505w160.C12; CH505w160.C14; CH505w160.D1; CH505w160.D5; CH505w160.T2; CH505w160.T4; CH505.w4.26 ; CH505.w30.12 ; CH505.w53.19 ; C505w020.2.

The selections of CH505-Envs were down-selected from a series of 400 CH505 Envs isolated by single-genome amplification followed for 3 years after acute infection, based on experimental data. The enhanced neutralization breadth that developed in the CD4-binding site (bs) CH103 antibody lineage that arose in subject CH505 developed in conjunction with epitope diversification in the CH505's viral quasispecies. It was observed that at 6 months post-infection in there was more diversification in the CD4bs epitope region in this donor than sixteen other acutely infected donors. Population breadth did not arise in the CH103 antibody lineage until the epitope began to diversify. A hypothesis is that the CH103 linage drove viral escape, but then the antibody adapted to the relatively resistant viral variants. As this series of events was repeated, the emerging antibodies evolved to tolerate greater levels of diversity in relevant sites, and began to be able to recognize and neutralize diverse heterologous forms for the virus and manifest population breadth. In certain embodiments, eight envs are selected from CH505 sequences to reflect diverse variants for making Env pseudoviruses, with the goal of recapitulating CH505 HIV-1 antigenic diversity over time, making sure selected site (i.e. those sites reflecting major antigenic shifts) diversity was represented.

Specifically, for CH505 the virus and envelope evolution were mapped, and the CH103 CD4 binding-site bnAb evolution. In addition, 135 CH505 varied envelope pseudotyped viruses were made and tested them for neutralization sensitivity by members of the CH103 bnAb lineage (e.g, FIGS. 13, 29-30). From this large dataset, in one embodiment, eight Env variants were chosen for immunization based on three major criteria: Env mutants with sites under diversifying selection, in which the transmitted/founder (T/F) Env form vanished below 20% in any sample, i.e. escape variants; signature sites based on autologous neutralization data, i.e. Envs with statistically supported signatures for escape from members of the CH103 bnAb lineage; and sites with mutations at the contact sites of the CH103 antibody and HIV Env. From a set of candidate envs, eight Envs with mutations in these characteristic sites and representative of Envs with these criteria were chosen. In this manner, a sequential swarm of Envs was selected for immunization to represent the progression of virus escape mutants that evolved during bnAb induction and increasing neutralization breadth in the CH505 donor.

In certain embodiments, additional two sequences are selected to contain five additional specific amino acid signatures of resistance that were identified at the global population level. These sequences contain statistically defined resistance signatures, which are common at the population level and enriched among heterologous viruses that CH103 fails to neutralize. When they were introduced into the TF sequence, they were experimentally shown to confer partial resistance to antibodies in the CH103 lineage. Following the reasoning that serial viral escape and antibody adaptation to escape is what ultimate selects for neutralizing antibodies that exhibit breadth and potency against diverse variants, in certain embodiments, inclusion of these variants in a vaccine may extend the breadth of vaccine-elicited antibodies even beyond that of the CH103 lineage. Thus the overarching goal will be to trigger a CH103-like lineage first using the CH505TF modified M11, that is well recognized by early CH103 ancestral states, then vaccinating with antigenic variants, to allow the antibody lineage to adapt through somatic mutation to accommodate the natural variants that arose in CH505. In certain embodiments, vaccination regimens include a total of eight sequences (Selection H) that capture the antigenic diversity of CH505. In another embodiment, the two sequences that introduce the population signatures are added (Selection I), to enable the induction of antibodies by vaccination that may have even greater breadth than those antibodies isolated from CH505.

The eight CH505 sequences that represent the accumulation of viral sequence and antigenic diversity in the CD4bs epitope of CH103 in subject CH505: M11 (TF with N279D+V281G), w004.03, w030.28, w053.16, w053.31, w078.15, w078.33, w100.B6.

M11 is a mutant generated to include two mutations in the loop D (N279D+V281G relative to the TF sequence) that enhanced binding to the CH103 lineage (see FIG. 29). These were early escape mutations for another CD4bs autologous neutralizing antibody lineage, but might have served to promote early expansion of the CH103 lineage.

In certain embodiments, the two CH103 resistance signature-mutation sequences added to the antigenic swarm are: M14 (TF with S364P), and M24 (TF with S375H+T202K+L520F +G459E) (See FIG. 30). They confer partial resistance to the TF with respect to the CH103 lineage. In certain embodiments, these D-loop mutants are administered in the boost.

In certain embodiments, two additional CH505 variants, w078.7 & w100.A4, are added to the selections to extend to further extend the sampling of the antigenic profile.

Example 3

Immunization protocols in subjects with swarms of HIV-1 envelopes

Immunization protocols contemplated by the invention include envelopes sequences as described herein including but not limited to nucleic acids and/or amino acid sequences of gp160s, gp150s, gp145, cleaved and uncleaved gp140s, gp120s, gp41s, N-terminal deletion variants as described herein, cleavage resistant variants as described herein, or codon optimized sequences thereof. A skilled artisan can readily modify the gp160 and gp120 sequences described herein to obtain these envelope variants. The swarm immunization protocols can be administered in any subject, for example monkeys, mice, guinea pigs, or human subjects.

In non-limiting embodiments, the immunization includes a nucleic acid is administered as DNA, for example in a modified vaccinia vector (MVA). In non-limiting embodiments, the nucleic acids encode gp160 envelopes. In other embodiments, the nucleic acids encode gp120 envelopes. In other embodiments, the boost comprises a recombinant gp120 envelope. The vaccination protocols include envelopes formulated in a suitable carrier and/or adjuvant, for example but not limited to alum. In certain embodiments the immnuzations include a prime, as a nucleic acid or a recombinant protein, followed by a boost, as a nucleic acid or a recombinant protein. A skilled artisan can readily determine the number of boosts and intervals between boosts.

Table 4 shows a non-limiting example of an immunization protocol using a swarm of four HIV-1 envelopes


Envelope
Prime
Boost(s)
Boost(s)
Boost(s)
w004.03
w004.03 as a
nucleic acid e.g.
DNA/MVA
vector and/or
protein
w053.16
w053.16
as a nucleic acid
e.g. DNA/MVA
and/or protein
w078.33
w078.33
as nucleic acid
e.g. DNA/MVA
and/or protein
W100.B6
W100.B6
as nucleic acid
e.g. DNA/MVA
and/or protein

Table 5 shows a non-limiting example of an immunization protocol using a swarm of four HIV-1 envelopes


Envelope
Prime
Boost(s)
Boost(s)
Boost(s)
w004.03
w004.03 as a
w004.03
w004.03
w004.03
nucleic acid e.g.
as a nucleic acid
as nucleic acid
as nucleic acid
DNA/MVA
e.g. DNA/MVA
e.g. DNA/MVA
e.g. DNA/MVA
vector and/or
and/or protein
and/or protein
and/or protein
protein
w053.16
w053.16
w053.16
w053.16
as nucleic acid
as nucleic acid
as nucleic acid
e.g. DNA/MVA
e.g. DNA/MVA
e.g. DNA/MVA
and/or protein
and/or protein
and/or protein
w078.33
w078.33
w078.33
as nucleic acid
as nucleic acid
eg. DNA/MVA
eg. DNA/MVA
and/or protein
and/or protein
W100.B6
W100.B6
as nucleic acid
e.g. DNA/MVA
and/or protein

Table 6 shows a non-limiting example of immunization protocol using a swarm of ten HIV-1 envelopes


Envelope
Prime
Boost(s)
Boost(s)
Boost(s)
T/F or
T/F or w004.03,
w004.03,
and M11 as
and M11
nucleic acids
and/or protein
w030.28
w030.28 as
nucleic acid
and/or protein
w053.16,
w053.16,
w053.31,
w053.31,
w078.7,
w078.7,
w078.15, and
w078.15, and
w078.33
w078.33 as
nucleic acids
and/or protein
W100.A4, and
W100.A4, and
W100.B6
W100.B6
nucleic acids
and/or protein

Table 7 shows a non-limiting example of immunization protocol using a swarm of ten HIV-1 envelopes


Envelope
Prime
Boost(s)
Boost(s)
Boost(s)
T/F or
T/F or w004.03,
T/F or w004.03,
T/F or w004.03,
T/F or w004.03,
w004.03,
and M11 as
and M11 as
and M11 as
and M11 as
and M11
nucleic acids
nucleic acids
nucleic acids
nucleic acids
and/or protein
and/or protein
and/or protein
and/or protein
w030.28
w030.28 as
w030.28 as
w030.28 as
nucleic acid
nucleic acid
nucleic acid
and/or protein
and/or protein
and/or protein
w053.16,
w053.16,
w053.16,
w053.31,
w053.31,
w053.31,
w078.7,
w078.7,
w078.7,
w078.15, and
w078.15, and
w078.15, and
w078.33
w078.33 as
w078.33 as
nucleic acids
nucleic acids
and/or protein
and/or protein
W100.A4, and
W100.A4, and
W100.B6
W100.B6
nucleic acids
and/or protein

Table 8 shows a non-limiting example of immunization protocol with a swarm of twelve HIV-1 envelopes


Envelope
Prime
Boost(s)
Boost(s)
Boost(s)
Boost(s)
T/F or
T/F or
w004.03, and
w004.03, and
M11
M11 as
nucleic acids
and/or protein
w014.12,
w014.12,
w014.32
w014.32 as
nucleic acid
and/or protein
w030.28
w030.28 as
nucleic acid
and/or protein
w053.16,
w053.16,
w053.31,
w053.31,
w078.7,
w078.7,
w078.15, and
w078.15, and
w078.33
w078.33 as
nucleic acids
and/or protein
W100.A4, and
W100.A4,
W100.B6
and W100.B6
nucleic acids
and/or protein

Table 9 shows a non-limiting example of immunization protocol with a swarm of twelve HIV-1 envelopes


Envelope
Prime
Boost(s)
Boost(s)
Boost(s)
Boost(s)
T/F or
T/F or
T/F or
T/F or
T/F or
T/F or
w004.03, and
w004.03, and
w004.03, and
w004.03, and
w004.03, and
w004.03, and
M11
M11 as
M11 as
M11 as
M11 as
M11 as
nucleic acids
nucleic acids
nucleic acids
nucleic acids
nucleic acids
and/or protein
and/or protein
and/or protein
and/or protein
and/or protein
w014.12,
w014.12,
w014.12,
w014.12,
w014.12,
w014.12,
w014.32
w014.32 as
w014.32 as
w014.32 as
w014.32 as
w014.32 as
nucleic acids
nucleic acids
nucleic acids
nucleic acids
nucleic acids
and/or protein
and/or protein
and/or protein
and/or protein
and/or protein
w030.28
w030.28 as
w030.28 as
w030.28 as
nucleic acid
nucleic acid
nucleic acid
and/or protein
and/or protein
and/or protein
w053.16,
w053.16,
w053.31,
w053.31,
w053.31,
w078.7,
w078.7,
w078.7,
w078.15, and
w078.15, and
w078.15, and
w078.33 as
w078.33
w078.33 as
nucleic acids
nucleic acids
and/or protein
and/or protein
W100.A4, and
W100.A4,
W100.B6
and W100.B6
nucleic acids
and/or protein

Table 10 shows a non-limiting example of an immunization protocol with HIV-1 envelopes.


Envelope
Prime
Boost(s)
Boost(s)
Boost(s)
Boost(s)
w000.TF, w004.03,
As nucleic
(optionally 004.26)
acids and/or
M10, M11, M19, M20,
proteins
M21, M5, M6, M7, M8,
M9.
w014.10, w014.2,
As nucleic
w014.21, w014.3,
acids and/or
w014.32, w014.8;
proteins
w020.3, w020.4, w020.7,
w020.8, w020.9,
w020.11, w020.13,
w020.14, w020.15,
w020.19, w020.22,
w020.23, w020.24,
w020.26
w030.5, w030.6, w030.9,
As nucleic
w030.10, w030.11,
acids and/or
w030.13, w030.15,
proteins
w030.17, w030.18,
w030.19, w030.20,
w030.21, w030.23,
w030.25, w030.27,
w030.28, w030.36
w053.3, w053.6,
As nucleic
w053.13, w053.16,
acids and/or
w053.25, w053.29,
proteins
w053.31, w078.1,
w078.6, w078.7, w078.9,
w078.10, w078.15,
w078.17, w078.25,
w078.33, w078.38
w100.A3, w100.A4,
As nucleic
w100.A6, w100.A10,
acids and/or
w100.A12, w100.A13,
proteins
w100.B2, w100.B4,
w100.B6, w100.B7,
w100.C7, w136.B2,
w136.B3, w136.B4,
w136.B5, w136.B8,
w136.B10, w136.B12,
w136.B18, w136.B20,
w136.B27, w136.B29,
w136.B36, w160.A1,
w160.C1, w160.C2,
w160.C4, w160.C11,
w160.C12, w160.C14,
w160.D1, w160.D5,
w160.T2, w160.T4

Table 11 shows a non-limiting example of immunization protocol using a swarm of HIV-1 envelopes. Optionally in certain embodiments the boosts include M14, and M24 as nucleic acids and/or protein.


Envelope
Prime
Boost(s)
Boost(s)
Boost(s)
T/F or
T/F or
w004.03,
w004.03,
and M11
and M11,
(M14 and M24
(optionally in
optional)
certain
embodiments
M14, and M24)
as nucleic acids
and/or protein
w030.28
w030.28 as
nucleic acid
and/or protein
w053.16,
w053.16,
w053.31,
w053.31,
w078.7,
(w078.7
w078.15, and
optional in
w078.33
certain
embodiments),
w078.15, and
w078.33 as
nucleic acids
and/or protein
W100.A4
(W100.A4
(optional), and
optional in
W100.B6
certain
embodiments),
and W100.B6
nucleic acids
and/or protein

Table 12 shows a non-limiting example of immunization protocol using a swarm of HIV-1 envelopes. Optionally in certain embodiments the boosts include M14, and M24 as nucleic acids and/or protein.


Envelope
Prime
Boost(s)
Boost(s)
Boost(s)
T/F or
T/F or
T/F or
T/F or
T/F or
w004.03,
w004.03,
w004.03,
w004.03,
w004.03,
and M11
and M11,
and M11,
and M11,
and M11,
(M14 and M24
(optionally in
(optionally in
(optionally in
(optionally in
optional)
certain
certain
certain
certain
embodiments
embodiments
embodiments
embodiments
M14, and M24)
M14, and M24)
M14, and M24)
M14, and M24)
as nucleic acids
as nucleic acids
as nucleic acids
as nucleic acids
and/or protein
and/or protein
and/or protein
and/or protein
w030.28
w030.28 as
w030.28 as
w030.28 as
nucleic acid
nucleic acid
nucleic acid
and/or protein
and/or protein
and/or protein
w053.16,
w053.16,
w053.16,
W053.31,
W053.31,
W053.31,
w078.7,
(w078.7
(w078.7
w078.15, and
optional in
optional in
w078.33
certain
certain
embodiments),
embodiments),
w078.15, and
w078.15, and
w078.33 as
w078.33 as
nucleic acids
nucleic acids
and/or protein
and/or protein
W100.A4
(W100.A4
(optional), and
optional in
W100.B6
certain
embodiments),
and W100.B6
nucleic acids
and/or protein

In certain embodiments an immunization protocol could include the following: Prime with a bivalent or trivalent Gag mosaic (Gag1 and Gag 2, Gag 1, Gag 2 and Gag3) in a suitable vector, plus CH505 Transmitted/Founder Env gp120 or gp160 plus T/F Env protein. Boost #1 could be: Gag1 and Gag-2 in a suitable vector, plus CH505 Transmitted/Founder Env gp120 or gp160, plus Env week 53 in a suitable vector, plus T/F and week 53 Env proteins. Boost #2 could be: Gag1 and Gag-2 in a suitable vector, plusCH505 week 78 , plus week 100 Env gp120 or gp160, plus week 78+week 100 Env proteins.

Example 4

Env mixtures of the CH505 virus induce the beginning of CD4 binding site BnAb lineages

Groups of Rhesus Macaques are immunized with CH505 gp120 variants as recombinant gp120 proteins: T/F, w053.16, w078.33, and w100.B6. Group 1: CH505 T/F env gp120; Group 2: w053.16, Group 3: w078.33; Group 4: Sequential of 4 Env immunization: T/F, w053.16, w078.33, and w100.B6; Group 5: Additive T/F, T/F+w053.16, T/F+w053.16 +w078.33, T/F+w053.16+w078.33+w100.B6.

Immunizations are ongoing, with only three immunizations thus far with recombinant gp120 proteins. FIG. 26 shows interim results of one monkey from Group 1. FIGS. 26 and 27 show that three immunizations with CH505 T/F envelope stimulate reactive memory B cells which are RSC3 positive (bind the gp120 CH505 T/F envelope) and do not bind RSCD371 (indicative of CD4Binding Site bnAb antibodies).

Previous studies have shown evolution of BnAbs through autologous Nabs. For example, it was reported evolution of V3 glycan (PGT-like) antibodies by induction of autologous NAbs that drove T/F virus escape with appearance of N332 in escape mutants, that could drive N332-dependent BnAbs (Nature Med. 18: 1688, 2012). Liao et al. reported evolution of the CH103 lineage through autologous NAbs in the CH103 lineage (Nature 496: 469, 2013).

Two virus types were isolated from CH505 BnAb individual four weeks after transmission: the Transmitted/Founder virus and a variant termed week 004.3 (4.3). Transmitted/founder virus was the predominant virus quasi-species at week 4 (tier 2). One variant virus termed 4.3 is identical to the T/F virus except it has a mutation in the gp41 MPER of W680G, and it is more neutralization sensitive to the entire CH103 clonal lineage including being neutralized by the CH103 UCA (Tier 1b).

FIG. 28 shows induction of autologous neutralization of both the transmitted/founder CH505 Env and neutralization sensitive CH505 Env variant w004.3 in NHPs immunized with recombinant gp120 forms of either the transmitted/founder Env, week 53.16, week 78.33 or week 100.B6 in either group 1, T/F alone X3 or in sequence (Group 4) or additive sequence (Group 5) as in line 117 above. Shown is week 14 neutralization data after three immunizations recombinant gp120 proteins as describe above.

Following virus and antibody evolution is providing important insight into the sequence of virus Envs that induce broadly neutralizing antibodies. B cell lineage vaccine design is a strategy to target the unmutated common ancestors and their intermediates for selecting otherwise subdominant and unfavored lineages. Lineage design coupled with structural analysis of envelope-antibody co-crystals is providing a rational design of immunogens for pre-clinical immunization studies. This example demonstrated induction of autologous neutralizing antibodies of the CH103 lineage. Next steps are immunization of germline KI mouse models (CH103 GL on the way) and humans with the same immunogens.

Example 5

One of the major obstacles to developing an efficacious preventive HIV-1 vaccine is the challenge of inducing broadly neutralizing antibodies (bnAbs) against the virus. There are several reasons why eliciting bnAbs has been challenging and these include the conformational structure of the viral envelope, molecular mimicry of host antigens by conserved epitopes which may lead to the suppression of potentially useful antibody responses, and the high level of somatic mutations in the variable domains and the requirement for complex maturation pathways [1-3]. It has been shown that up to 25% of HIV-1—infected individuals develop bnAbs that are detected 2-4 years after infection. To date, all bnAbs have one or more of these unusual antibody traits: high levels of somatic mutation, autoreactivity with host antigens, and long heavy chain third complementarity determining regions (HCDR3s)—all traits that are controlled or modified by host immunoregulatory mechanisms. Thus, the hypothesis has been put forth that typical vaccinations of single primes and boosts will not suffice to be able to induce bnAbs; rather, it will take sequential immunizations with Env immunogens, perhaps over a prolonged period of time, to mimic bnAb induction in chronically infected individuals [4].

A process to circumvent host immunoregulatory mechanisms involved in control of bnAbs is termed B cell lineage immunogen design, wherein sequential Env immunogens are chosen that have high affinities for the B cell receptors of the unmutated common ancestor (UCA) or germline gene of the bnAb clonal lineage [4]. Envs for immunization can either be picked randomly for binding or selected, as described herein, from the evolutionary pathways of Envs that actually give rise to bnAbs in vivo. Liao and colleagues recently described the co-evolution of HIV-1 and a CD4 binding site bnAb from the time of seroconversion to the development of plasma bnAb induction, thereby presenting an opportunity to map out the pathways that lead to generation of this type of CD4 binding site bnAb [5]. They showed that the single transmitted/founder virus was able to bind to the bnAb UCA, and identified a series of evolved envelope proteins of the founder virus that were likely stimulators of the bnAb lineage. Thus, this work presents the HVTN with an opportunity to vaccinate with naturally-derived viral envelopes that could drive the desired B-cell responses and induce the development of broad and potent neutralizing antibodies. While the human antibody repertoire is diverse, it has been found that only a few types of B cell lineages can lead to bnAb development, and that these lineages are similar across a number of individuals [6,7]. Thus, it is feasible that use of Envs from one individual will generalize to others.

The approach in this concept sheet to address the challenge of eliciting broadly neutralizing antibodies in vaccinees involves selecting the Env immunogens, among multitude of diverse viruses that induced a CD4 binding site bnAb clonal lineage in an HIV-infected individual, by making sequential recombinant Envs from that individual and using these Envs for vaccination. The B-cell lineage vaccine strategy thus includes designing immunogens based on unmutated ancestors as well as intermediate ancestors of known bnAb lineages. A candidate vaccine could use transmitted/founder virus envelopes to, at first, stimulate the beginning stages of a bnAb lineage, and subsequently boost with evolved Env variants to recapitulate the high level of somatic mutation needed for affinity maturation and bnAb activity. The goal of such a strategy is to selectively drive desired bnAb pathways.

Liao et al demonstrated that in the CHAVI CH505 bnAb individual, the CH103 CD4 binding site bnAb lineage started with the lineage members first developing autologous neutralizing antibody activity, and then as the CH505 Env mutated, it developed bnAb activity. Thus, the first step of bnAb development is the development of the ability to neutralize the transmitted/founder virus.

The CH505 transmitted/founder (T/F) virus that we propose to use in Trial 1 in the concept has been tested in rhesus macaques; after 3 immunizations it induced plasma antibodies that neutralized the T/F virus and an early (week 4) T/F variant with only one mutation. In addition, flow phenotypic analysis of memory B cells in CH505 T/F Env-immunized rhesus macaques has demonstrated the presence of antigen-specific memory B cells that bind the Env protein RSC3 but not the RSC3 371 mutant protein [8], strongly indicating B cells that have begun a CD4 binding site bnAb lineage.

In certain embodiments, the CH505 virus used in Trial# 1 and Trial #2 is w004.03 instead of CH505 T/F.

Broadly neutralizing antibodies likely will not be induced by a single Env, and even a mixture of polyvalent random Envs (e.g. HVTN 505) is unlikely to induce bnAbs. Rather, immunogens must be designed to trigger the UCAs of bnAb lineages to undergo initial bnAb lineage maturation, and then use sequential immunogens to fully expand the desired lineages. The proposed trial will represent the first of many experimental clinical trials testing this concept in order to develop the optimal set of immunogens to drive multiple specificities of bnAbs. The HVTN will be at the cutting edge of this effort.

The concept is applicable to driving CD4 binding site lineage in multiple individuals due to the convergence of a few bnAb motifs among individuals. The adjuvant will be the GSK AS01E adjuvant containing MPL and QS21. Other suitable adjuvants can be used. This adjuvant has been shown by GSK to be as potent as the similar adjuvant AS01B but to be less reactogenic using HBsAg as vaccine antigen [Leroux-Roels et al., IABS Conference, April 2013,9].

Trial #1 will involve 5 immunizations IM with the CH505 transmitted/founder (T/F) Env gp120 at months 0, 1, 3, 6 and 12 and evaluating different doses of protein. The follow up Trial #2 will have combinations of the T/F Env and week-53, week-78 and week-100 Env mutants. Because it takes over a year to develop bnAbs, the second trial will include the possibility of a month 18 boost as well.

This study aims to be the first of several iterative experimental phase I trials to test the ability of these Envs to initiate bnAb lineages, and to use the isolated B cells from the vaccinees to identify the lineages induced.

Hypotheses: The T/F vaccine strategy will be safe and well tolerated among HIV-uninfected individuals. The vaccine strategy will elicit HIV Env-specific binding antibodies in a dose-dependent manner. The vaccine will elicit autologous neutralizing antibodies to transmitted/founder viruses. The vaccine will induce CD4+ T cell responses. The vaccine will initiate CD4 binding site-specific-antibody lineages.

Proposed study


Schema Trial #1 (Dose finding): T/F = transmitted/founder protein
Month 1
Month 6
Month 12
Study arm
N
Dose
Month 0 (Day 0)
(Day 28)
Month 3 (Day 84)
(Day 168)
(Day 364)
Group 1
12
 10 mcg
T/F
T/F
T/F
T/F
T/F
Group 2
12
 20 mcg
T/F
T/F
T/F
T/F
T/F
Group 3
12
100 mcg
T/F
T/F
T/F
T/F
T/F
Group 4
6
placebo
placebo
placebo
placebo
placebo
Total
42
(36/6)

Products: CH505TF: HIV gp120 transmitted/founder with AS01E; Placebo for CH505TF: sodium chloride for injection

Participants: 42 healthy, HIV-1-uninfected volunteers aged 18 to 50 years

Number of participants: Total 42: 36 vaccine, 6 placebo

Study duration: 18 months per participant [HVTN standard is 6 months after last vaccination.]

Objectives and endpoints

Primary objective 1: To evaluate the safety and tolerability of different doses of a prime-boost regimen of CH505TF vaccine in HIV-uninfected healthy adults

Primary endpoint 1: Local and systemic reactogenicity signs and symptoms, laboratory measures of safety, and AEs and SAEs

Primary objective 2: To evaluate binding antibody responses elicited by different doses of the CH505TF vaccine

Primary endpoint 2: HIV-specific binding Ab responses as assessed by binding Ab multiplex assay two weeks after the fourth vaccination

Secondary objective 1: To evaluate the ability of the regimen to elicit HIV-specific nAbs

Secondary endpoint 1: nAb magnitude and breadth against autologous viral isolates as assessed by area under the magnitude-breadth curves two weeks after the fourth vaccination

Secondary objective 2: To evaluate HIV-specific T-cell responses induced by different doses of the CH505TF vaccine

Secondary endpoint 2: Response rate and magnitude of CD4+ T-cell responses as assessed by intracellular cytokine staining assays (ICS) two weeks after the fourth vaccination

Exploratory objectives:

To further evaluate the immunogenicity of the vaccine regimen at different timepoints

To isolate single B cells with desired specificities and determine lineage characteristics

To determine the B cell repertoire of HIV-specific B cells

To assess vaccine-induced follicular helper T cell (Tfh) responses

Study design considerations

Trial #1 is a dose finding trial to evaluate the safety and immunogenicity of the transmitted/founder gp120 protein, CH505TF. The first protocol will be used in establishing an IND. CH505TF will be available for clinical use approximately 6-7 months before additional three gp 120 proteins, representing variants from later timepoints in infection, are available. Assuming an acceptable safety and immunogenicity profile, trial #2 would follow with combinations of the T/F Env and week 53, 78 and 100 Env mutants. The doses for trial #2 will be informed by data from Trial #1. Because it takes over a year to develop bnAbs, the second trial will include the possibility of a month 18 boost as well. Combined, these studies will test the ability of these Envs to initiate bnAb lineages and to use the isolated B cells from the vaccinees to identify the lineages induced.


Schema Trial #2 (Sequential doses)
Month 18
Month 0
Month 1
Month 3
Month 6
Month
(Day
Study arm
N
(Day 0)
(Day 28)
(Day 84)
(Day 168)
12 (Day 364)
546)
Group
12
100 mcg
100 mcg
100 mcg
100 mcg
100 mcg
100 mcg
1
T/F
53
78
100
Swarm
Swarm
Group
12
100 mcg
100 mcg
100 mcg
100 mcg
100 mcg
100 mcg
2
T/F +
53 +
78 +
100 +
Swarm
Swarm
4 mg DNA
4 mg DNA
4 mg DNA
4 mg DNA
mosaic
mosaic
mosaic
mosaic
Group
12
100 mcg
 50 mcg
33 mcg
100 mcg
100 mcg
100 mcg
3
T/F
T/F + 50 mcg
T/F +33 mcg
Swarm
Swarm
Swarm
53
53 +33 mcg
78
Group
12
100 mcg
100 mcg
100 mcg
100 mcg
100 mcg
100 mcg
4
Swarm
Swarm
Swarm
Swarm
Swarm
Swarm
Group
12
placebo
placebo
placebo
placebo
placebo
placebo
5
Total
60
(48/12)
Notes:
T/F = transmitted/founder protein;
Swarm = mixture of T/F, 53, 78, and 100; Example protein doses included, total actual dose to be informed by Trial #1

Products: CH505TF: transmitted/founder HIV gp120 with ASO1E; CH505w53.1: week 53 HIV gp120 with ASO1E; CH505w78.33: week 78 HIV gp120 with ASO1E; CH505w100.6: week 100 HIV gp120 with ASO lE

DNA Mosaic env: trivalent vaccine composed of mosaic HV13284, HV13285 and HV13286 that optimizes global coverage. All express gp160 Env protein. In certain embodiments, bivalvent mosaic envelopes can be used. Placebo: sodium chloride for injection.

Statistical considerations

Accrual and sample size calculations: Recruitment into trial #1 will target 42 healthy, HIV-uninfected adults aged 18 to 50 years old at low risk of HIV infection in regions where clade B is the predominant clade. Enrollment will be concurrent with receiving the first study vaccination, thus all participants will provide some safety data. For immunogenicity analyses, however, it is possible that data may be missing for various reasons such as participants terminating from the study early, problems in shipping specimens, or low cell viability of processed peripheral blood mononuclear cells (PBMCs). Immunogenicity data from 11 phase 1 and 1 phase 2a HVTN trials, which began enrolling after June 2005 (data as of June 2011), indicate that 10% is a reasonable estimate for the rate of missing data. For this reason, the sample size calculations below account for 10% of enrolled participants having missing data for the primary immunogenicity endpoint.

Sample size calculations for safety: The ability of the study to identify SAEs can be expressed by the true event rate above which at least 1 event would likely be observed and the true event rate below which no events would likely be observed. Specifically, in each vaccine arm of the study (n=12), there is a 90% chance of observing at least 1 event if the true rate of such an event is 17.5% or more; and there is a 90% chance of observing no events if the true rate is 0.8% or less. In all vaccine arms of the study combined (n=36), there is a 90% chance of observing at least 1 event if the true rate of such an event is 6.2% or more; and there is a 90% chance of observing no events if the true rate is 0.2% or less.

Sample size calculations for immunogenicity: To address antibody endpoints, the analysis will descriptively summarize binding response positivity call rates and test superiority of the magnitude and breadth of the IgG binding Ab response to a panel of gp120 proteins for each of two comparisons (Group 1 vs 2, Group 2 vs 3), using a two-sided Wilcoxon rank sum test with 2.5% type-I error rate per comparison. The sample size of 12 vaccinees per group will give 80% power to detect a true difference of 1.82 standard deviations (SDs) between the mean non-zero responses and 90% power to detect a true difference of 2.04 SDs. These calculations assume a 10% loss-to-follow-up rate and the (94%) response rate observed in the HVTN 088 vaccine recipients. The same approach will be used to test superiority of the magnitude of the IgG binding Ab response to each individual gp120 antigen in the panel.

References

1. Mascola J R, Haynes B F. HIV-1 neutralizing antibodies: understanding nature's pathways. Immunol Rev 2013; 254:225-44.

2. Verkoczy L, Kelsoe G, Moody M A, Haynes B F. Role of immune mechanisms in induction of HIV-1 broadly neutralizing antibodies. Curr Opin Immunol 2011; 23:383-90.

3. Verkoczy L, Chen Y, Zhang J, Bouton-Verville H, Newman A, Lockwood B, Scearce R M, Montefiori D C, Dennison S M, Xia S M, Hwang K K, Liao H X, Alam S M, Haynes B F. Induction of HIV-1 broad neutralizing antibodies in 2F5 knock-in mice: selection against membrane proximal external region-associated autoreactivity limits T-dependent responses. J Immunol 2013; 191:2538-50.

4. Haynes B F, Kelsoe G, Harrison S C, Kepler T B. B-cell-lineage immunogen design in vaccine development with HIV-1 as a case study. Nat Biotechnol 2012; 30:423-33.

5. Liao H X, Lynch R, Zhou T, Gao F, Alam S M, Boyd S D, Fire A Z, Roskin K M, Schramm C A, Zhang Z, Zhu J, Shapiro L, Mullikin J C, Gnanakaran S, Hraber P, Wiehe K, Kelsoe G, Yang G, Xia S M, Montefiori D C, Parks R, Lloyd K E, Scearce R M, Soderberg K A, Cohen M, Kamanga G, Louder M K, Tran L M, Chen Y, Cai F, Chen S, Moquin S, Du X, Joyce M G, Srivatsan S, Zhang B, Zheng A, Shaw G M, Hahn B H, Kepler T B, Korber B T, Kwong P D, Mascola J R, Haynes B F. Co-evolution of a broadly neutralizing HIV-1 antibody and founder virus. Nature 2013; 496:469-76.

6. Morris L, Chen X, Alam M, Tomaras G, Zhang R, Marshall D J, Chen B, Parks R, Foulger A, Jaeger F, Donathan M, Bilska M, Gray E S, Abdool Karim S S, Kepler T B, Whitesides J, Montefiori D, Moody M A, Liao H X, Haynes B F. Isolation of a human anti-HIV gp41 membrane proximal region neutralizing antibody by antigen-specific single B cell sorting. PLoS One 2011; 6:e23532.

7. Zhou T, Zhu J, Wu X, Moquin S, Zhang B, Acharya P, Georgiev I S, Altae-Tran H R, Chuang G Y, Joyce M G, Do K Y, Longo N S, Louder M K, Luongo T, McKee K, Schramm C A, Skinner J, Yang Y, Yang Z, Zhang Z, Zheng A, Bonsignori M, Haynes B F, Scheid J F, Nussenzweig M C, Simek M, Burton D R, Koff W C, Mullikin J C, Connors M, Shapiro L, Nabel G J, Mascola J R, Kwong P D. Multidonor analysis reveals structural elements, genetic determinants, and maturation pathway for HIV-1 neutralization by VRC01-class antibodies. Immunity 2013; 39:245-58.

8. Lynch R M, Tran L, Louder M K, Schmidt S D, Cohen M, Dersimonian R, Euler Z, Gray E S, Abdool K S, Kirchherr J, Montefiori D C, Sibeko S, Soderberg K, Tomaras G, Yang Z Y, Nabel G J, Schuitemaker H, Morris L, Haynes B F, Mascola J R. The Development of CD4 Binding Site Antibodies During HIV-1 Infection. J Virol 2012; 86:7588-95.

9. Leroux-Roels I, Koutsoukos M, Clement F, Steyaert S, Janssens M, Bourguignon P, Cohen K, Altfeld M, Vandepapeliere P, Pedneault L, McNally L, Leroux-Roels G, Voss G. Strong and persistent CD4+T-cell response in healthy adults immunized with a candidate HIV-1 vaccine containing gp120, Nef and Tat antigens formulated in three Adjuvant Systems. Vaccine 2010; 28:7016-24.

Example 6

DNA and mRNA vaccination for mimicking HIV envelope evolution during broad neutralizing antibody induction

In certain aspects the invention provides compositions and methods for HIV-1 vaccine development: DNA and RNA delivery system (for example but not limited by the Nanotaxi® nanoparticle delivery technology), as well as the B Cell Lineage Vaccine Design concept. This example will study the hypothesis that the critical factor for generation of broadly neutralizing antibodies (bnAbs) is exposure of the B cell repertoire to swarms of Env mutants that have developed over time such that the B cells induced both retain the ability to neutralize swarms of autologous viruses, while acquiring the ability to neutralize heterologous viruses.

B Cell lineage vaccine design concepts envision multiple immunogens to target the unmutated common ancestors (UAs) and intermediate antibodies (IAs) of clonal lineages of potentially protective antibodies to induce these UAs to begin maturation to generate protective antibody responses. Translational studies aimed at testing such concepts are required; however, the key would be to select appropriate immunogens that can be easily delivered either as a mix or in sequential manner and to determine the appropriate frequency of administrations. Nanotaxi®-based immunogens allows for easy handling and manipulations for such a complex set of vaccine immunogens.

The example will use the new CH505 set of T/F and sequential evolved Env envelopes (in certain embodiments the set includes 103/104 envelopes—Table 14) that gave rise to the CH103 bNAb lineage to generated broadly neutralizing CD4 binding site (bs) bnAb responses. In certain embodiment, w004.03 envelope is used instead of CH505 T/F envelope. In certain embodiments, D-loop mutants are optionally included. The CH505 set of Envs is derived from the CHAVI bnAb individual, CH505 who is one of the CHAVI001 cohort of Africans who were followed from the time of acute HIV infection to the development of high titers of bnAbs. CH505 plasma neutralizing activity and resulting CH103 lineage bnAbs are targeted to the CD4 binding site (Nature 496: 469, 2013). A series of evolved viruses were chosen which will be tested as either mRNAs or DNAs, for example but not limited administered by the Nanotaxi® technology.

Once synthesized, the Nanotaxi® immunogens will be fully characterized as chemical entities using existing analytical approaches. Physico-chemical analyses will be performed by Nuclear Magnetic Resonance (NMR), Mass Spectrometry (MS) and High-Performance Liquid Chromatography (HPLC) to ensure both the identity and the purity of the compounds. Once the Nanotaxi® are prepared, they will be formulated with DNA and mRNA, following a self-assembling process. The formulation will in turn be characterized, in terms of size and zeta potential of the complexed Nanotaxi®.

Stage 1. Comparison of the immunogenicity of DNAs vs. mRNAs expressed in Nanotaxi® formulation. For this comparison, we will make 4 sequential CH505 Envs as DNA vs mRNA gp120s and gp160s in the presence or in the absence of an immunostimulatory sequence (IS) linked to the CH505 env genes and then formulate them with Nanotaxi® and test their immunogenicity in C57BL6 mice for their ability to induce anti-Env antibodies. Each of the 4 Envs will be tested both alone as a prime-boost injection model, and with recombinant protein administered either as a boost or co-administered with the DNA or mRNA. In certain embodiments gp145 is used instead of gp160.

Below is a list of groups to be tested:

Groups 1, 2, 3 and 4—Immunization with each gp120 DNA formulated with Nanotaxi® X4.

Groups 5, 6, 7 and 8—Immunization with each gp120-IS DNA formulated with Nanotaxi® X4.

Groups 9, 10, 11 and12—Immunization with each gp160 DNA formulated with Nanotaxi® X4.

Groups 13, 14, 15 and 16—Immunization with each gp160-IS formulated with DNA Nanotaxi® X4.

Groups 17, 18, 19 and 20—Immunization with each gp120 mRNA formulated with Nanotaxi® X4.

Groups 21, 22, 23, and 24—Immunization with each gp120-IS mRNA formulated with Nanotaxi® X4.

Groups 25, 26, 27 and 28—Immunization with each gp160 mRNA formulated with Nanotaxi® X4.

Groups 29, 30, 31 and 32—Immunization with each gp160-IS mRNA formulated with Nanotaxi® X4.

Groups 33, 34, 35 and 36—Immunization with each Env gp120 protein alone X4

Groups 37, 38, 39 and 40—Immunization with each Env gp140 protein alone X4

Groups 41, 42, 43 and 44—Immunization with each Env as optimal genetic form from studies above (mRNA vs. DNA with or without the immunostimulatory sequence (IS); gp120 vs. gp160) in sequential format.

Groups 45, 46, 47 and 48—Immunization with each Env as optimal genetic form from studies above (mRNA vs. DNA with or without the immunostimulatory sequence(IS); gp120 vs. gp160) in sequential format, combined with four homologous Envs as proteins—delivered simultaneously with mRNA or DNAs.

All immunizations will be performed intramuscularly (IM) with 6 C57BL6 mice per group. Mouse immunizations will be followed for induction of titers of CH505 Env antibodies by ELISA. Other suitable non-human animal models can be used.

Once comparisons are made per above, a series of comparisons will be made of the optimal genetic immunizations given IM alone vs IM with Nanotaxi® as follows to ensure that Nanotaxi® is the optimal administration mode.

Group 49—Immunization with DNA or mRNA alone IM X4

Group 50—Immunization with DNA or mRNA formulated with Nanotaxi® IM X4.

Stage 2. Study of the immunogenicity of the optimized DNA or mRNA CH505 gp160 or gp120 Envs formulated with Nanotaxi® in CD4 binding site CH103 germline knockin mice and rhesus macaques. Here we will take the most immunogenic form of genetic immunization from Stage 1 and formulate 100 sequential evolved Envs for administration in the following manner:

For CH103 germline knockin mice:

Group 1 Immunization with DNA or mRNA formulated with Nanotaxi® with CH505 transmitted/founder (T/F) Env first, followed by a mixture of the next Envs, followed by a mixture of the next 33 Envs, followed by a mixture of the final Envs. Loop D mutants could be included in either prime and/or boost.

Group 2 Immunization with DNA or mRNA formulated with Nanotaxi® with CH505 transmitted/founder (T/F) Env first, followed by a mixture of the next 32 Envs, followed by a mixture of the next 33 Envs, followed by a mixture of the final 33 Envs. Here the genetic immunization will be the same as in group 1 except each immunization will be accompanied by 4 (T/F, week 53, week 78, week 100) CH505 Env protein as gp120s.

For Rhesus Macaques (NHP study #79)

Key is to determine how long it is necessary to immunize and what a precise regimen might be regarding sequential, additive or swarm types if immunizations. NHP study #79 is already ongoing and can inform the work by determining how long immunizations are needed and also by providing a protein only control set of experiments.

NHP #79 is divided into 6 groups (4 animals per group) as follows:

Group 1. Immunization with the Transmitted/Founder Env gp120 alone X5; last immunization finished 11/21/13; induced autologous (CH505 T/F) neutralizing antibodies (slides 1 and 2 above) ; animals now being studied for VH and VL lineages induced. Once autologous Nabs isolated, plans are next to boost with “swarm” of all 4 Envs.

Group 2. Immunization with second Env (week 53) only X5.

Group 3. Immunization with third Env (week 78) only X5.

Group 4. Immunization with sequential T/F, then week 53, then week 78, then week 100 Env, then a swarm of all 4 was completed; induced autologous Neutralizing antibodies of CH505 founder virus (FIGS. 26-29); animals now being studied for VH and VL lineage induced.

Group 5. Immunization with additive Envs (T/F first then T/F+53; then T/F+53+78; then T/F+53+78+100) then swarm of all 4 ; last immunization finished 11/21/13; induced autologous neutralizing antibodies; animals now being studied for VH and VL lineages induced.

Group 6. Immunization with fourth Env (week 100) only X5.

It took ˜90 weeks for heterologous nAbs to appear in the CH505 plasma, and it took ˜136 weeks for full bnAb activity to appear. Thus, a major way the NHP #79 study can inform the future studies to project how long and how many immunizations will be needed using genetic immunization.

Secondly, a key protocol to evaluate is the contribution of protein to genetic immunization when proteins are added to mRNA or DNA immunizations. We believe that that the most effective way to immunize will likely be the simultaneous combination of nucleotides in Nanotaxi® plus proteins. Thus, the NHP #79 studies probe the route and use of proteins alone.

NHP Study for testing of genetic immunization of swarms of Envs in rhesus macaques.

Group 1 Immunization with DNA or mRNA formulated with Nanotaxi® with CH505 transmitted/founder (T/F) Env first, followed by a mixture of the next Envs, followed by a mixture of the next Envs, followed by a mixture of the final Envs.

Group 2 Immunization with DNA or mRNA formulated with Nanotaxi® with CH505 transmitted/founder (T/F) Env first, followed by a mixture of the next Envs, followed by a mixture of the next Envs, followed by a mixture of the final Envs. Here the genetic immunization will be the same as in group 1 except each immunization will be accompanied by 4 (T/F, week 53, week 78, week 100) CH505 Env protein as gp120s.

All immunizations will be performed IM with 6 rhesus macaques per group. Immunizations will continue for 2.5 years in the rhesus macaques. NHP immunizations will be followed for induction of titers of CH505 Env antibodies, and the repertoire of clonal lineages of antibodies induced will be determined by a) memory B cell sorts using the CH505 gp120 as a fluorophor-labeled “hook”, b) clonal memory B cell cultures with screening for single cells producing bnAbs, c) Atreca Inc. (Immune Repertoire Capture™ technology) screens of extent of clonal diversity using either plasma cells or memory B cells sorts with maintenance of VH and VL natural pairs, and d) Illumina MiSeq analysis of clonal expansions in NHPs with the vaccinations.

In addition, we will genetic immunizations in two types of humanized mice: the KYMAB® lambda mice (CH103 utilizes Vλ3-1) and our CH103 knockin mice that only express the germline VH4-59 and V13-1 genes of CH103 lineage. The latter mice will test the integrity of the Env immunogens for triggering of the CH103 lineage in the absence of germinal center competition for space by other clones, and the KYMAB® lambda mice will test the immunogens in a wildtype repertoire system much as in the rhesus macaques.

For both mouse lines, we will test 12 mice per group and the mode of monitoring the response will be identical to that in rhesus macaques.

Each of the models above has their advantages and disadvantages.

The CH103 GL mouse has the advantage of being able to see exactly what the CH505 immunogens can do for the CH103 lineage. The disadvantage is that the T cells are mouse and the Ig repertoire is human.

The KYMAB lambda mouse has the advantage of having the entire VH and Vlambda human repertoire and has the disadvantage of having mouse T helper cells and TFH.

The rhesus has the advantage of being primate and being most similar to human in repertoire and TFH cells with the disadvantage of cost and not being human. Nonetheless, the rhesus macaque for these immunogenicity studies is most like human of all the models and if our strategy works in rhesus macaques, we believe this is the best indicator that it will work in humans.

Stage 3. GMP Production of the 100 “Swarm” of CH505 Evolved Envs As Either DNAs or mRNAs (Downselected from Stage 1 above).

This stage of the project will consist in producing by subcontracting with a GMP manufacturer of plasmid DNA or mRNA molecules depending on the selected format. Subcontractors have already been identified by the members of the present proposal. Discussion with manufacturers will aim to define the timelines and the cost for the production of the 100 “swarm” of CH505 Evolved Env as DNAs or mRNAs. For proteins, the CH505 T/F, week 53, week 78 and week 100 gp120 Envs are already produced in bulk under GMP conditions for use in Phase I clinical trials, and these Envs will be available to for use with genetic immunization in Phase 1 trials should the genetic immunizations as “swarms” be successful in CH103 knockin mice and/or rhesus macaques.

Milestones

Stage 1. Decide on mRNA vs DNA regarding optimal immunogenicity in C57BL/6 mice. Criteria for deciding will be based on titers of CH505 Env antibodies in mouse plasma.

Stage 2. Criteria for proceeding to GMP DNA or mRNA production with Nanotaxi® formulation will be the demonstration in the CH103 bnAb germline knockin mice of the DNA or mRNA/NanoTaxi® formulation to induce clonal lineages of VH4-59—the VH of the CH103 lineage, or Vλ3-1, or induce any clonal lineages with binding to RSC3 protein but not to the RSC3 protein with an isoleucine deleted at position 371 (signifying a CD4 binding site BnAb lineage).

Similarly, criteria for proceeding to GMP DNA or mRNA production with Nanotaxi® formulation in KYMAB lambda mice and rhesus macaques will be for the DNA or mRNA/NanoTaxi® formulation to induce clonal lineages of the orthologues of VH4-59—the VH of the CH103 lineage, or orthologues of Vλ3-1, or induce any clonal lineages with binding to RSC3 protein but not to the RSC3 protein with an isoleucine deleted at position 371 (signifying a CD4 binding site BnAb lineage).

Thus, if either the right lineages are induced in the CH103 germline knockin mouse model or in KYMAB lambda mice or in rhesus macaques, we will move forward to GMP production. We will have this very high bar as a go-no go decision, since moving to stage 3 will be relatively expensive. That is to say, we will need to know our immunogens are inducing the correct lineages prior to moving to Stage 3.

Stage 3. Criteria for moving to a Phase I clinical trial will be the above immunogenicity in rhesus macaques, and the ability to scale up and produce the 100 Envs as DNAs or RNAs with NanoTaxi®.


SEQUENCE LISTING
The patent contains a lengthy “Sequence Listing” section. A copy of the “Sequence Listing” is available in electronic form from the USPTO web site (). An electronic copy of the “Sequence Listing” will also be available from the USPTO upon request and payment of the fee set forth in 37 CFR 1.19(b)(3).

<160> NUMBER OF SEQ ID NOS: 665

<140> CURRENT APPLICATION NUMBER: US/15/126,220

<210> SEQ ID NO 1

<211> LENGTH: 9699

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 1

tggaagggtt agtttactcc aagaaaagac aagagatcct tgatttgtgg gtctataaca 60

cacaaggctt cttccctgat tggcaaaact acacaccggg accaggggtc agatatccac 120

tgacctttgg atggtgcttc aagctagtgc cagtcgatcc agaggaagta gaagaggcca 180

ataaaggaga aaacaactgc ttactacacc ctatgagcca gcatggaatg gatgatgagg 240

acagagaagt actaaagtgg aagtttgaca gtcagctagc acgcagacac atggcccgcg 300

agctacatcc ggagtggtac aaagactgct gacacagaag ggactttccg ctgggacttt 360

ccactggggc gttccagggg gagtggtctg ggcgggactg ggagtggcca accctcagat 420

gctgcatata agcagctgct tttcgcctgt actgggtctc tctaggtaga ccagatctga 480

gcccgggagc tctctgacta cctagggaac ccactgctta agcctcaata aaagcttgcc 540

ttgagtgctc taagtagtgt gtgcccgtct gttgtgtgac tctggtaact agagatccct 600

cagacccttt gtggtagtgt ggaaaatctc tagcagtggc gcccgaacag ggacttgaaa 660

gcgaaagtag aaccagagga gatctctcga cgcaggactc ggcttgctga agtgcactcg 720

gcaagaggcg agagcggcgg ctggtgagta cgccaaattt tatttgacta gcggaggcta 780

gaaggagaga gatgggtgcg agagcgtcaa tattaagagg gggaaaatta gataaatggg 840

aaagaattag gttaaggcca gggggaaaga aatgctatat gataaaacac ttagtatggg 900

caagcaggga gttggaaaga tttgcactta atcctggcct cttagaaaca tcagaaggct 960

gtagacaaat aataaagcag ctacaaccat ctcttcagac aggaacagag gaacttagat 1020

cattatataa cacagtagta actctctatt gtgtacatga agagatagaa gtacgagaca 1080

ccaaagaagc cttagacaaa ctagaggaag aacaaaacaa atgtcagcaa aaagcacagc 1140

aagcagaggc ggctgacaaa ggaaaggtca gccaaaatta tcctatagta cagaatctcc 1200

aagggcaaat ggtacaccag cccctatcac ctagaacttt gaatgcatgg gtgaaagtaa 1260

tagaagagaa gggttttaac ccagaggtaa tacccatgtt ttcagcatta tcagaaggag 1320

ccaccccaca agacttaaac accatgttaa atacagtagg gggacatcaa gcagccatgc 1380

aaatgttgaa agataccatc aatgaggagg ctgcagaatg ggatagatta catccagtcc 1440

atgcagggcc tattgcacca ggccaaatga gagaaccaag gggaagtgat atagcaggaa 1500

caactagcaa ccttcaggaa caaatagcat ggatgacagc taacccacct atcccagtgg 1560

gagaattgta taaaagatgg ataattctgg gattaaataa aatagtaaga atgtatagcc 1620

ctgtcagcat tttggacata aaacaagggc caaaagaacc ctttagagac tatgtagacc 1680

ggttctttaa aactttgaga gctgaacaag ctacacaaga tgtaaaaaat tggatgacag 1740

acaccttgtt gacccaaaat gcgaacccag attgtaagac cattttaaga gcattaggac 1800

caggggctac attagaagaa atgatgacag catgccaagg agtgggagga cctagccaca 1860

aagcaagagt gctagctgaa gcaatgagcc aagtaaatca tccaaacata atgatgcaga 1920

gaaacaattt taaaggacca aaaagaattg ttaaatgctt caactgtggc aaggaagggc 1980

acatagccag aaattgcagg gcacctagga aaaggggctg ttggaaatgt ggaaaggaag 2040

gacaccaaat gaaagactgt actgaaaggc aggctaattt tttagggaaa atttggcctt 2100

cccacaaggg gaggccaggg aatttcatcc agaacaggct agagcccaca gccccaccag 2160

cagagagttt caggttcgag gagacaaccc ccagtctgaa gcaggagccg aaggagaggg 2220

aaccaccctt aacttccctc aaatcactct ttggcagcga ccccttgtct caataagagt 2280

agggggccag ataaaggagg ctctcttaga cacaggagca gatgatacag tattagaaga 2340

aataaatttg ccagggaaat ggaaaccaaa aatgatagga ggaattggag gctttatcaa 2400

agtaagacag tatgatcaaa tatctataga aatttgtgga aaaaaggcta taggtacagt 2460

attagtggga cctacacctg tcaacataat tggaaggaat ctgttgactc agcttggatg 2520

tacattaaat tttccaatta gtcccattga aactgtacca gtaaaattaa agccaggaat 2580

ggatggccca aaagttaaac aatggccatt gacagaagag aaaataaaag cattaacagc 2640

aatctgtgaa gacatggaga aggaaggaaa aatttcaaaa attgggcctg aaaatccata 2700

taacactcca gtatttgcca taaaaaagaa ggacagtaca aagtggagaa aattagtaga 2760

tttcagggaa ctcaacaaga gaactcaaga cttctgggaa gttcaactag gaataccaca 2820

cccagcaggg ttaaaaaaga aaaaatcagt gacagtacta gatgtggggg atgcatattt 2880

ttcagtacct ttagatgaag gcttcaggaa atatactgcg ttcaccatac ctagtataaa 2940

caatgaaaca ccagggatta gatatcaata taatgtgctt ccacagggat ggaaaggatc 3000

accagcaata ttccagagta gcatgacaaa aatcttagag ccctttagga taaaaaatcc 3060

agacatagtt atctatcaat atatggatga cttgtatgta ggatctgact tagaattagg 3120

acagcataga gcaaaaatag aagagctaag ggaacattta ttaaaatggg gacttaccac 3180

accagacaag aaacatcaaa aagaaccccc atttctttgg atggggtatg aactccatcc 3240

tgacaaatgg acagtacagc ctataaagct gccagacaag gaaagctgga ctgtcaatga 3300

tatacaaaag ttagtaggaa aattaaactg ggcaagtcag atttacccag ggattaaagt 3360

aaggcaactc tgtaaactcc ttaggggggc caaagcacta acagacatag taccactaac 3420

tgaagaagca gaattagaat tggcagagaa cagggaaatt ctaaaagaac cagtacatgg 3480

agtatattat gaccctgcta aagaattaat agctgaaata cagaagcagg ggcatgacca 3540

atggacatac caaatttacc aagaaccatt caaaaatctg aaaacaggaa agtatgcaaa 3600

aatgagggct gcccatacca atgatgtaaa gcaattaaca gaggcagtgc aaaaaatagc 3660

tacagaaagc atagtaatat ggggaaagac ccctaagttt agattaccca tccaaaaaga 3720

aacatgggag acatggtgga cagactattg gcaggctacc tggattcctg agtgggagta 3780

tgttaatact cctcccctag taaaattatg gtaccaactg gaaaaagaac ccatagtagg 3840

agtagaaact ttctatgtag atggagcagc taatagggaa actaagttag gaaaagcagg 3900

gtatgttact gacaggggaa ggcagaaagt cgtttcccta actgaaacaa caaatcagaa 3960

ggctgagtta caagcaattc agttagcttt gcaggattca ggatcagaag taaacatagt 4020

aacagactca cagtatgcat taggaatcat tcaagcacaa ccagataaga gtgaatcagg 4080

gttagttaac caaataatag aacagttaat aaacaaggaa agaatctacc tgtcatgggt 4140

accagcacat aagggaattg gagggaatga acaagtggac aaattagtaa gtaaggggat 4200

caggaaagtg ctgtttctag atggaataga gaaggctcaa gaagagcatg aaagatatca 4260

caacaattgg agagcaatgg ctagtgagtt taatctgcca cccatagtag caaaagaaat 4320

agtagctagc tgtgataaat gtcagttaaa aggggaagcc atacatggac aagtagactg 4380

tagtccaggg atatggcaat tagactgcac acatttagaa ggaaaaacta tcttggtagc 4440

agtccatgta gccagtggct acatagaagc agaggtcatt ccagcagaaa caggacaaga 4500

aacagcatac tatatactaa aattagcagg aagatggcca gtcaaaatga tacatacaga 4560

caatggcagt aatttcacca gtgctgcagt taaggcagcc tgttggtggg cgggtatcca 4620

acaggaattt ggaattccct acaatcccca aagtcaggga gtagtagaat ccatgaataa 4680

agaattaaag aaaatcatag ggcaagtaag agatcaagct gagcacctta agacagcagt 4740

acaaatggca gtattcattc acaattttaa aagaaaaggg gggattgggg ggtacagtgc 4800

aggggaaaga ataatagaca tgatagcaac agacatacaa actaaagaat tacaaaaaca 4860

aattataaaa attcaaaatt ttcgggttta ttacagagac agcagagatc ctatttggaa 4920

aggaccagcc aaactactct ggaaaggtga aggggcagta gtcatacaag ataacagtga 4980

cataaaggta gtaccaagaa ggaaagtaaa aatcattagg gactatggaa aacagatggc 5040

aggtgctgat tgtgtggcag gtagacagga tgaggattag aacatggcac agtttagtaa 5100

agcaccacat gtatgtctca aggagagcta gtggatggtt ctacagacct cattatgcaa 5160

gtagacatcc aaaaataagt tcagaggtac acatcccatt aggggaggct agattagtaa 5220

taacaacata ttggggtttg caaacaggag aaagagagtg gcacttaggt aatggagcct 5280

ccatagaatg gagaatgaga aaatatagca cacaaataga tcctggcctg gcagaccagc 5340

taattcatat gcattatttt gattgttttg cagactctgc cataagaaaa gccatattag 5400

gacatatagt tatccctagg tgtgactatc aagcaggaca taataaggta ggatctcttc 5460

aatacttggc actgacagca ttgataaaac caaaaaagag aaagccacct ctgcctagtg 5520

ttaagaaatt agtagaggat agatggaaca acccccagaa gaccaggggc cgcagaggga 5580

accatataac gagtggacac tagaactctt agaggaactc aagcaggaag ctgtcagaca 5640

ctttcctaga ccatggctcc atgcattagg acaacatatc tatgatacct atggggatac 5700

ttggacagga gttgaagcta taataagaat acttcaacag ttactgttta ctcatttcag 5760

aattgggtgc caacatagca gaataggcat tctgcgacag agaagagcaa gaaatggagc 5820

cagtagaccc taacctagag ccctggaatc atccaggaag tcagcccaaa actccttgta 5880

ataagtgtta ttgtaagcga tgctgctatc attgtctagt ttgctttcag acaaaaggct 5940

taggcatttc ccatggcagg aagaagcgga gacagcgacg aagcgctcct ccaagcagtg 6000

agaatcatca aaatccttta tcaaagcagt gagtattcaa taagcatatg taatgtttga 6060

tttatatgca agagtagatt atagaatagg agtaggagca ttggcaatag cactaatcat 6120

agcaataata gtgtggacca tagtatatat agaatatagg aaattagtaa gacaaagaaa 6180

aatagaccag ttaattaaaa gaattaggga aagagcagaa gacagtggca atgagagtga 6240

tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc ttttggatgc 6300

taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg tggaaagaag 6360

caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa gtgcataatg 6420

tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg gttttaaaaa 6480

atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg catgaagatg 6540

taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca ctctgtgtca 6600

ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga atgaaaaatt 6660

gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat gcactttttt 6720

ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta ataaattgta 6780

atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt cctatacatt 6840

attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc actggaacag 6900

gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca gtggtttcaa 6960

ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga tctgaaaata 7020

taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag attgagtgta 7080

cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa gcattttatg 7140

caacaggaca agtaatagga gacataagag aagcatattg taacattaat gaaagtaaat 7200

ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct cataagaata 7260

taacatttca accatcctca ggaggggacc tagaaattac aacacatagc tttaattgtg 7320

gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat atggctaata 7380

gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca atccactgca 7440

gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat gcccctccca 7500

ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca agggatggag 7560

gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac aattggagaa 7620

gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca cccactaatg 7680

caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct gtgttccttg 7740

ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg acggtacagg 7800

ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag gctatagagg 7860

ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag gcaagagtcc 7920

tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc tgctctggaa 7980

aactcatctg caccactaat gtatattgga actctagttg gagtaataaa acttatggtg 8040

atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat tatacagaaa 8100

taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa caagatttac 8160

tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat tggctgtggt 8220

atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata atttttgctg 8280

tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg cagaccctta 8340

tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt ggagagcaag 8400

acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg gacgacctgc 8460

ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt gcagcgagag 8520

cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg gaagccctta 8580

agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt gctattagtc 8640

tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta gaatttgtat 8700

taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc tttgaaacag 8760

ctttgctata aaatgggggg caagtggtca aaaagcagta tagttggatg gcctgatgta 8820

agagaaagaa taagaagaac tgatccagca gcagagggag taggagcagc atctcaagac 8880

ttagatagac atggggcact tacaattaac aacacagccg ccaataatgc tgattgtgcc 8940

tggctggagg cacaagagga ggagggagaa gtaggctttc cagtcagacc tcaggtacct 9000

ttaagaccaa tgacttataa ggaagcattc gacctcagct tctttttaaa agaaaagggg 9060

ggactggaag ggttagttta ctccaagaaa agacaagaga tccttgattt gtgggtctat 9120

aacacacaag gcttcttccc tgattggcaa aactacacac cgggaccagg ggtcagatat 9180

ccactgacct ttggatggtg cttcaagcta gtgccagtcg atccagagga agtagaagag 9240

gccaataaag gagaaaacaa ctgcttacta caccctatga gccagcatgg aatggatgat 9300

gaggacagag aagtactaaa gtggaagttt gacagtcagc tagcacgcag acacatggcc 9360

cgcgagctac atccggagtg gtacaaagac tgctgacaca gaagggactt tccgctggga 9420

ctttccactg gggcgttcca gggggagtgg tctgggcggg actgggagtg gccaaccctc 9480

agatgctgca tataagcagc tgcttttcgc ctgtactggg tctctctagg tagaccagat 9540

ctgagcccgg gagctctctg actacctagg gaacccactg cttaagcctc aataaaagct 9600

tgccttgagt gctctaagta gtgtgtgccc gtctgttgtg tgactctggt aactagagat 9660

ccctcagacc ctttgtggta gtgtggaaaa tctctagca 9699

<210> SEQ ID NO 2

<211> LENGTH: 1485

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 2

atgggtgcga gagcgtcaat attaagaggg ggaaaattag ataaatggga aagaattagg 60

ttaaggccag ggggaaagaa atgctatatg ataaaacact tagtatgggc aagcagggag 120

ttggaaagat ttgcacttaa tcctggcctc ttagaaacat cagaaggctg tagacaaata 180

ataaagcagc tacaaccatc tcttcagaca ggaacagagg aacttagatc attatataac 240

acagtagtaa ctctctattg tgtacatgaa gagatagaag tacgagacac caaagaagcc 300

ttagacaaac tagaggaaga acaaaacaaa tgtcagcaaa aagcacagca agcagaggcg 360

gctgacaaag gaaaggtcag ccaaaattat cctatagtac agaatctcca agggcaaatg 420

gtacaccagc ccctatcacc tagaactttg aatgcatggg tgaaagtaat agaagagaag 480

ggttttaacc cagaggtaat acccatgttt tcagcattat cagaaggagc caccccacaa 540

gacttaaaca ccatgttaaa tacagtaggg ggacatcaag cagccatgca aatgttgaaa 600

gataccatca atgaggaggc tgcagaatgg gatagattac atccagtcca tgcagggcct 660

attgcaccag gccaaatgag agaaccaagg ggaagtgata tagcaggaac aactagcaac 720

cttcaggaac aaatagcatg gatgacagct aacccaccta tcccagtggg agaattgtat 780

aaaagatgga taattctggg attaaataaa atagtaagaa tgtatagccc tgtcagcatt 840

ttggacataa aacaagggcc aaaagaaccc tttagagact atgtagaccg gttctttaaa 900

actttgagag ctgaacaagc tacacaagat gtaaaaaatt ggatgacaga caccttgttg 960

acccaaaatg cgaacccaga ttgtaagacc attttaagag cattaggacc aggggctaca 1020

ttagaagaaa tgatgacagc atgccaagga gtgggaggac ctagccacaa agcaagagtg 1080

ctagctgaag caatgagcca agtaaatcat ccaaacataa tgatgcagag aaacaatttt 1140

aaaggaccaa aaagaattgt taaatgcttc aactgtggca aggaagggca catagccaga 1200

aattgcaggg cacctaggaa aaggggctgt tggaaatgtg gaaaggaagg acaccaaatg 1260

aaagactgta ctgaaaggca ggctaatttt ttagggaaaa tttggccttc ccacaagggg 1320

aggccaggga atttcatcca gaacaggcta gagcccacag ccccaccagc agagagtttc 1380

aggttcgagg agacaacccc cagtctgaag caggagccga aggagaggga accaccctta 1440

acttccctca aatcactctt tggcagcgac cccttgtctc aataa 1485

<210> SEQ ID NO 3

<211> LENGTH: 3003

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 3

ttttttaggg aaaatttggc cttcccacaa ggggaggcca gggaatttca tccagaacag 60

gctagagccc acagccccac cagcagagag tttcaggttc gaggagacaa cccccagtct 120

gaagcaggag ccgaaggaga gggaaccacc cttaacttcc ctcaaatcac tctttggcag 180

cgaccccttg tctcaataag agtagggggc cagataaagg aggctctctt agacacagga 240

gcagatgata cagtattaga agaaataaat ttgccaggga aatggaaacc aaaaatgata 300

ggaggaattg gaggctttat caaagtaaga cagtatgatc aaatatctat agaaatttgt 360

ggaaaaaagg ctataggtac agtattagtg ggacctacac ctgtcaacat aattggaagg 420

aatctgttga ctcagcttgg atgtacatta aattttccaa ttagtcccat tgaaactgta 480

ccagtaaaat taaagccagg aatggatggc ccaaaagtta aacaatggcc attgacagaa 540

gagaaaataa aagcattaac agcaatctgt gaagacatgg agaaggaagg aaaaatttca 600

aaaattgggc ctgaaaatcc atataacact ccagtatttg ccataaaaaa gaaggacagt 660

acaaagtgga gaaaattagt agatttcagg gaactcaaca agagaactca agacttctgg 720

gaagttcaac taggaatacc acacccagca gggttaaaaa agaaaaaatc agtgacagta 780

ctagatgtgg gggatgcata tttttcagta cctttagatg aaggcttcag gaaatatact 840

gcgttcacca tacctagtat aaacaatgaa acaccaggga ttagatatca atataatgtg 900

cttccacagg gatggaaagg atcaccagca atattccaga gtagcatgac aaaaatctta 960

gagcccttta ggataaaaaa tccagacata gttatctatc aatatatgga tgacttgtat 1020

gtaggatctg acttagaatt aggacagcat agagcaaaaa tagaagagct aagggaacat 1080

ttattaaaat ggggacttac cacaccagac aagaaacatc aaaaagaacc cccatttctt 1140

tggatggggt atgaactcca tcctgacaaa tggacagtac agcctataaa gctgccagac 1200

aaggaaagct ggactgtcaa tgatatacaa aagttagtag gaaaattaaa ctgggcaagt 1260

cagatttacc cagggattaa agtaaggcaa ctctgtaaac tccttagggg ggccaaagca 1320

ctaacagaca tagtaccact aactgaagaa gcagaattag aattggcaga gaacagggaa 1380

attctaaaag aaccagtaca tggagtatat tatgaccctg ctaaagaatt aatagctgaa 1440

atacagaagc aggggcatga ccaatggaca taccaaattt accaagaacc attcaaaaat 1500

ctgaaaacag gaaagtatgc aaaaatgagg gctgcccata ccaatgatgt aaagcaatta 1560

acagaggcag tgcaaaaaat agctacagaa agcatagtaa tatggggaaa gacccctaag 1620

tttagattac ccatccaaaa agaaacatgg gagacatggt ggacagacta ttggcaggct 1680

acctggattc ctgagtggga gtatgttaat actcctcccc tagtaaaatt atggtaccaa 1740

ctggaaaaag aacccatagt aggagtagaa actttctatg tagatggagc agctaatagg 1800

gaaactaagt taggaaaagc agggtatgtt actgacaggg gaaggcagaa agtcgtttcc 1860

ctaactgaaa caacaaatca gaaggctgag ttacaagcaa ttcagttagc tttgcaggat 1920

tcaggatcag aagtaaacat agtaacagac tcacagtatg cattaggaat cattcaagca 1980

caaccagata agagtgaatc agggttagtt aaccaaataa tagaacagtt aataaacaag 2040

gaaagaatct acctgtcatg ggtaccagca cataagggaa ttggagggaa tgaacaagtg 2100

gacaaattag taagtaaggg gatcaggaaa gtgctgtttc tagatggaat agagaaggct 2160

caagaagagc atgaaagata tcacaacaat tggagagcaa tggctagtga gtttaatctg 2220

ccacccatag tagcaaaaga aatagtagct agctgtgata aatgtcagtt aaaaggggaa 2280

gccatacatg gacaagtaga ctgtagtcca gggatatggc aattagactg cacacattta 2340

gaaggaaaaa ctatcttggt agcagtccat gtagccagtg gctacataga agcagaggtc 2400

attccagcag aaacaggaca agaaacagca tactatatac taaaattagc aggaagatgg 2460

ccagtcaaaa tgatacatac agacaatggc agtaatttca ccagtgctgc agttaaggca 2520

gcctgttggt gggcgggtat ccaacaggaa tttggaattc cctacaatcc ccaaagtcag 2580

ggagtagtag aatccatgaa taaagaatta aagaaaatca tagggcaagt aagagatcaa 2640

gctgagcacc ttaagacagc agtacaaatg gcagtattca ttcacaattt taaaagaaaa 2700

ggggggattg gggggtacag tgcaggggaa agaataatag acatgatagc aacagacata 2760

caaactaaag aattacaaaa acaaattata aaaattcaaa attttcgggt ttattacaga 2820

gacagcagag atcctatttg gaaaggacca gccaaactac tctggaaagg tgaaggggca 2880

gtagtcatac aagataacag tgacataaag gtagtaccaa gaaggaaagt aaaaatcatt 2940

agggactatg gaaaacagat ggcaggtgct gattgtgtgg caggtagaca ggatgaggat 3000

tag 3003

<210> SEQ ID NO 4

<211> LENGTH: 579

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 4

atggaaaaca gatggcaggt gctgattgtg tggcaggtag acaggatgag gattagaaca 60

tggcacagtt tagtaaagca ccacatgtat gtctcaagga gagctagtgg atggttctac 120

agacctcatt atgcaagtag acatccaaaa ataagttcag aggtacacat cccattaggg 180

gaggctagat tagtaataac aacatattgg ggtttgcaaa caggagaaag agagtggcac 240

ttaggtaatg gagcctccat agaatggaga atgagaaaat atagcacaca aatagatcct 300

ggcctggcag accagctaat tcatatgcat tattttgatt gttttgcaga ctctgccata 360

agaaaagcca tattaggaca tatagttatc cctaggtgtg actatcaagc aggacataat 420

aaggtaggat ctcttcaata cttggcactg acagcattga taaaaccaaa aaagagaaag 480

ccacctctgc ctagtgttaa gaaattagta gaggatagat ggaacaaccc ccagaagacc 540

aggggccgca gagggaacca tataacgagt ggacactag 579

<210> SEQ ID NO 5

<211> LENGTH: 291

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 5

atggaacaac ccccagaaga ccaggggccg cagagggaac catataacga gtggacacta 60

gaactcttag aggaactcaa gcaggaagct gtcagacact ttcctagacc atggctccat 120

gcattaggac aacatatcta tgatacctat ggggatactt ggacaggagt tgaagctata 180

ataagaatac ttcaacagtt actgtttact catttcagaa ttgggtgcca acatagcaga 240

ataggcattc tgcgacagag aagagcaaga aatggagcca gtagacccta a 291

<210> SEQ ID NO 6

<211> LENGTH: 306

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 6

atggagccag tagaccctaa cctagagccc tggaatcatc caggaagtca gcccaaaact 60

ccttgtaata agtgttattg taagcgatgc tgctatcatt gtctagtttg ctttcagaca 120

aaaggcttag gcatttccca tggcaggaag aagcggagac agcgacgaag cgctcctcca 180

agcagtgaga atcatcaaaa tcctttatca aagcaaccct tatcccaagc ccgaggggac 240

cagacaggcc cggaggaatc gaagaagaag gtggagagca agacagaaac agatcaacgc 300

gattag 306

<210> SEQ ID NO 7

<211> LENGTH: 372

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 7

atggcaggaa gaagcggaga cagcgacgaa gcgctcctcc aagcagtgag aatcatcaaa 60

atcctttatc aaagcaaccc ttatcccaag cccgagggga ccagacaggc ccggaggaat 120

cgaagaagaa ggtggagagc aagacagaaa cagatcaacg cgattagtga gcggattctt 180

agcgcttgtc tgggacgacc tgcggagcct gtgccttttc atctaccacc gattgagaga 240

cttcatatta attgcagcga gagcggggga acttctggga cgcagcagtc tcaagggact 300

acggagagga tgggaagccc ttaagtatct gggaagtctt gtgcagtatt ggggcctgga 360

actaaaaagg ag 372

<210> SEQ ID NO 8

<211> LENGTH: 261

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 8

atgtttgatt tatatgcaag agtagattat agaataggag taggagcatt ggcaatagca 60

ctaatcatag caataatagt gtggaccata gtatatatag aatataggaa attagtaaga 120

caaagaaaaa tagaccagtt aattaaaaga attagggaaa gagcagaaga cagtggcaat 180

gagagtgatg gggatacaga ggaattatcc acaatggtgg atatggagca tgttaggctt 240

ttggatgcta atgatttgta a 261

<210> SEQ ID NO 9

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 9

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 10

<211> LENGTH: 624

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 10

atggggggca agtggtcaaa aagcagtata gttggatggc ctgatgtaag agaaagaata 60

agaagaactg atccagcagc agagggagta ggagcagcat ctcaagactt agatagacat 120

ggggcactta caattaacaa cacagccgcc aataatgctg attgtgcctg gctggaggca 180

caagaggagg agggagaagt aggctttcca gtcagacctc aggtaccttt aagaccaatg 240

acttataagg aagcattcga cctcagcttc tttttaaaag aaaagggggg actggaaggg 300

ttagtttact ccaagaaaag acaagagatc cttgatttgt gggtctataa cacacaaggc 360

ttcttccctg attggcaaaa ctacacaccg ggaccagggg tcagatatcc actgaccttt 420

ggatggtgct tcaagctagt gccagtcgat ccagaggaag tagaagaggc caataaagga 480

gaaaacaact gcttactaca ccctatgagc cagcatggaa tggatgatga ggacagagaa 540

gtactaaagt ggaagtttga cagtcagcta gcacgcagac acatggcccg cgagctacat 600

ccggagtggt acaaagactg ctga 624

<210> SEQ ID NO 11

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 11

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 12

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 12

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacgcatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctggggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 13

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 13

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg taagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 14

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 14

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaaaaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 15

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 15

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagacg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gtgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaaa 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

aaatttgtat taggaatttg tagagctatc cgaaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 16

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 16

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagacg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt attaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaaa 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggaa agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

aaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 17

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 17

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccgctgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgccg tgctttcgtt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 18

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 18

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tggcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aatcatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaaaagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagacggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 19

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 19

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagagatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtatca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tggcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aatcatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tatcggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 20

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 20

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac cctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

tttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagagaga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agagcaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccgctgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagcctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 21

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 21

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatatg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actaccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattagt 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagt 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gcacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccgctgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagcagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aggtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 22

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 22

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct aatgccagca ataacagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tggcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattagt 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aatcatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt cacattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 23

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 23

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atatcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tggcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gatataagag aagcatattg taacattagt 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aatcatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 24

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 24

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccaaca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tggcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattagt 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccgctgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggaaaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taagaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 25

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 25

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtacataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccaaca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgccaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga aacataagag aagcatattg taacattagt 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

ctccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 26

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 26

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca ataacagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgccaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagaa aagcatattg taacattagt 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

ctccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 27

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 27

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actaccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattagt 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acaatacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 28

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 28

atgagagtga tggggataca aaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actaccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgttagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaataaga aacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaaa 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tagccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 29

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 29

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actaccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgccaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagaa aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acaatacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcggg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta aatatctggg aagtcttgtg cagtattggg gcctggaatt aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 30

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 30

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actaccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgccaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagaa aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccgctgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg gattcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgcctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 31

<211> LENGTH: 2538

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 31

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct gccagcaata gcagtataat agagggaatg 420

aaaaattgct ctttcaatat aaccacagaa ttaagagata agagagagaa aaagaatgca 480

cttttttata aacttgatat agtacaacta gatggcaact ctagtcagta tagattaata 540

aattgtaata cctcagtcat aacacaagcc tgtccaaagg tctcttttga cccaattcct 600

atacattatt gtgctccagc tggttatgcg attctaaagt gtaataataa gacattcact 660

ggaacaggac cgtgtaataa tgtcagcaca gtacaatgta cacatggaat taagccagtg 720

gtttcaactc aactattgtt aaatggtagc ctagcagaag gagagataat aattagatct 780

gaaaatataa caaacaatgc caaaacaata atagtacatc tcaatgaatc tgtaaagatt 840

gagtgtacga gacccaataa taaaacaaga acaagtataa gaataggacc aggacaagca 900

ttttatgcaa caggacaagt aataggagac ataagaaaag catattgtaa cattaatgaa 960

agtaaatgga atgaaacttt acaaagggta agtaaaaaat taaaagaata cttccctcat 1020

aagaatataa catttcaacc atcctcagga ggggacctag aaattacaac acatagcttt 1080

aattgtggag gagaattttt ctattgcaat acatcaagcc tgtttaatag gacatatatg 1140

gctaatagta cagatatggc taatagtaca gaaactaaca atacacgaac catcacaatc 1200

cactgcagaa taaaacaaat tataaacatg tggcaggagg tgggacgagc aatgtatgcc 1260

cctcccattg caggaaacat aacatgtata tcaaatatca caggactact attgacaagg 1320

gatggaggaa aaaacaatac ggagacattc agacctggag gaggaaatat gaaggacaat 1380

tggagaagtg aattatataa atataaagtg gtagaagtta agccattagg agtagcaccc 1440

actaatgcaa gaaggagagt ggtggaaaga gaaaaaagag cagtgggaat gggagctgtg 1500

ttccttgggt tcttgggagc ggcaggaagc actatgggcg cagcatcaat aacgctgacg 1560

gtacaggcca gacaattatt gtctggtata gtgcaacagc aaagcaattt gctgaaggct 1620

atagaggctc aacagcatat gttgaaactc acggtctggg gcattaaaca gctccaggca 1680

agagtcctgg ccttggaaag atacctaaag gatcaacagc tcctagggat gtggggctgc 1740

tctggaaaac tcatctgcac cactaatgta tattggaact ctagttggag taataaaact 1800

tatggtgata tttgggataa catgacctgg atgcagtggg agagagaaat tagcaattat 1860

acagaaataa tatatgaatt gcttgaagaa tcacaaaacc agcaggaaaa gaatgaacaa 1920

gatttactag cattggacag atggaacagt ctgtggaatt ggtttaacat aacaaattgg 1980

ctgtggtata taaaaatatt cataatgata gtaggaggct tgataggttt aagaataatt 2040

tttgctgtgc tttctttagt aaatagagtt aggcagggat actcacctct gtcgttgcag 2100

acccttatcc caagcccgag gggaccagac aggcccggag gaatcgaaga agaaggtgga 2160

gagcaagaca gaaacagatc aacgcgatta gtgagcggat tcttagcgct tgcctgggac 2220

gacctgcgga gcctgtgcct tttcatctac caccgattga gagacttcat attaattgca 2280

gcgagagcgg gggaacttct gggacgcagc agtctcaagg gactacggag aggatgggaa 2340

gcccttaagt atctgggaag tcttgtgcag tattggggcc tggaactaaa aaggagtgct 2400

attagtctat tggataccct agcaatagca gtaggtgaag gaacagatag gattctagaa 2460

tttgtattag gaatttgtag agctatccgc aacataccta caagaataag acagggcttt 2520

gaaacagctt tgctataa 2538

<210> SEQ ID NO 32

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 32

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atgctactgc cagcaatagc 420

agtataatag agggaatgaa aaattgctct ttcaatataa ccacagaatt aagagataag 480

agagagaaaa agaatgcact tttttataaa cttgatatag tacaactaga tggcaactct 540

agtcagtata gattaataaa ttgtaatacc tcagtcataa cacaagcctg tccaaaggtc 600

tcttttgacc caattcctat acattattgt gctccagctg gttatgcgat tctaaagtgt 660

aataataaga cattcactgg aacaggaccg tgtaataatg tcagcacagt acaatgtaca 720

catggaatta agccagtggt ttctactcaa ctattgttaa atggtagcct agcagaagga 780

gagataataa ttagatctga aaatataaca aacaatgtca aaacaataat agtacatctc 840

aatgaatctg taaagattga gtgtacgaga cccaataata aaacaagaaa aagtataaga 900

ataggaccag gacaagcatt ttatgcaaca ggacaagtaa taggagacat aagagaagca 960

tattgtaaca ttagtgaaag taaatggaat gaaactttac aaagggtaag taaaaaatta 1020

aaagaatact tccctcataa gaatataaca tttcaaccat cctcaggagg ggacctagaa 1080

attacaacac atagctttaa ttgtggagga gaatttttct attgcaatac atcaagcctg 1140

tttaatagga catatatggc taatagtaca gatatggcta atagtacaga aactaacagt 1200

acacgaacca tcacaatccg ctgcagaata aaacaaatta taaacatgtg gcaggaggtg 1260

ggacgagcaa tgtatgcccc tcccattgca ggaaacataa catgtatatc aaatatcaca 1320

ggactactat tgacaaggga tggaggaaaa aacaatacgg agacattcag acctggagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agttggagta ataaaactta tggtgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac agaaataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cgttacagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg tctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag gatgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaagga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 33

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 33

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atgctactgc cagcaatagc 420

agtataatag agggaatgaa aaattgctct ttcaatataa ccacagaatt aagagataag 480

agagagaaaa agaatgcact tttttataaa cttgatatag tacaactaga tggcaactct 540

agtcagtata gattaataaa ttgtaatacc tcagtcataa cacaagcctg tccaaaggtc 600

tcttttgacc caattcctat acattattgt gctccagctg gttatgcgat tctaaagtgt 660

aataataaga cattcactgg aacaggaccg tgtaataatg tcagcacagt acaatgtaca 720

catggaatta agccagtggt ttctactcaa ctattgttaa atggtagcct agcagaagga 780

gagataataa ttagatctga aaatataaca aacaatgtca aaacaataat agtacatctc 840

aatgaatctg taaagattga gtgtacgaga cccaataata aaacaagaaa aagtataaga 900

ataggaccag gacaagcatt ttatgcaaca ggacaagtaa taggagacat aagagaagca 960

tattgtaaca ttaatgaaag taaatggaat gaaactttac aaagggtaag taaaaaatta 1020

aaagaatatt tccctcataa gaatataaca tttcaaccat cctcaggagg ggacctagaa 1080

attacaacac atagctttaa ttgtggagga gaatttttct attgcaatac atcaagcctg 1140

tttaatagga catatatggc taatagtaca gatatggcta atagtacaga aactaacagt 1200

acacgaacca tcacaatccg ctgcagaata aaacaaatta taaacatgtg gcaggaggtg 1260

ggacgagcaa tgtatgcccc tcccattgca ggaaacataa catgtatatc aaatatcaca 1320

ggactactat tgacaaggga tggaggaaaa aacaatacgg agacattcag acctggagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agttggagta ataaaactta tggtgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac agaaataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cgttacagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg tctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag gatgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaagga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 34

<211> LENGTH: 2562

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 34

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca ataccaatgc tactgccagc 420

aatagcagta caatagaggg aatgaaaaat tgctctttca atataaccac agaattaaga 480

gataagagag agaaaaagaa tgcacttttt tataaacttg atatagtaca actagatggc 540

aactctagtc agtatagatt aataaattgt aatacctcag tcataacaca agcctgtcca 600

aaggtctctt ttgacccaat tcctatacat tattgtgctc cagctggtta tgcgattcta 660

aagtgtaata ataagacatt cactggaaca ggaccgtgta ataatgtcag cacagtacaa 720

tgtacacatg gaattaagcc agtggtttca actcaactat tgttaaatgg tagcctagca 780

gaaggagaga taataattag atctgaaaat ataacaaaca atgccaaaac aataatagta 840

catctcaatg aatctgtaaa gattgagtgt acgagaccca ataataaaac aagaacaagt 900

ataagaatag gaccaggaca agcattttat gcaacaggac aagtaatagg aaacataaga 960

gaagcatatt gtaacattag tgaaagtaaa tggaatgaaa ctttacaaag ggtaagtaaa 1020

aaattaaaag aatacttccc tcataagaat ataacatttc aaccatcctc aggaggggac 1080

ctagaaatta caacacatag ctttaattgt ggaggagaat ttttctattg caatacatca 1140

agcctgttta ataggacata tatggctaat agtacagata tggctaatag tacagaaact 1200

aacagtacac gaatcatcac aatccactgc agaataaaac aaattataaa catgtggcag 1260

gaggtgggac gagcaatgta tgcccctccc attgcaggaa acataacatg tatatcaaat 1320

atcacaggac tactattgac aagggatgga ggaaaaaaca atacggagac attcagacct 1380

ggaggaggaa atatgaagga caattggaga agtgaattat ataaatataa agtggtagaa 1440

gttaagccat taggagtagc acccactaat gcaagaagga gagtggtgga gagagaaaaa 1500

agagcagtgg gaatgggagc tgtgttcctt gggttcttgg gagcggcagg aagcactatg 1560

ggcgcagcat caataacgct gacggtacag gccagacaat tattgtctgg tatagtgcaa 1620

cagcaaagca atttgctgaa ggctatagag gctcaacagc atatgttgaa actcacggtc 1680

tggggcatta aacagctcca ggcaagagtc ctggccttgg aaagatacct aaaggatcaa 1740

cagctcctag ggatgtgggg ctgctctgga aaactcatct gcaccactaa tgtatattgg 1800

aactctagtt ggagtaataa aacttatggt gatatttggg ataacatgac ctggatacag 1860

tgggagagag aaattagcaa ttatacagaa ataatatatg aattgcttga agaatcacaa 1920

aaccagcagg aaaagaatga acaagattta ctagcattgg acagatggaa cagtctgtgg 1980

aattggttta acataacaaa ttggctgtgg tatataaaaa tattcataat gatagtagga 2040

ggcttgatag gtttaagaat aatttttgct gtgctttctt tagcaaatag agttaggcag 2100

ggatactcac ctctgtcgtt gcagaccctt atcccaagcc cgaggggacc agacaggccc 2160

ggaggaatcg aagaagaagg tggagagcaa gacagaaaca gatcaacgcg attagtgagc 2220

ggattcttag cgcttgtctg ggacgacctg cggagcctgt gccttttcat ctaccaccga 2280

ttgagagact tcatattaat tgcagcgaga gcgggggaac ttctgggacg cagcagtctc 2340

aagggactac ggagaggatg ggaagccctt aagtatctgg gaagtcttgt gcagtattgg 2400

ggcctggaac taaaaaggag tgctattagt ctattggata ccctagcaat agcagtaggt 2460

gaaggaacag ataggattct agaatttgta ttaggaattt gtagagctat ccgcaacata 2520

cctacaagaa taagacaggg ctttgaaaca gctttgctat aa 2562

<210> SEQ ID NO 35

<211> LENGTH: 2527

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 35

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taaagggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tttgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atatcagtaa tagaggaaat 420

gaaaaattgc tctttcaata taaccacaga attaagagat aagagagaga aaaagaatgc 480

acttttttat aaacttgata tagtacaact agatggcaac tctagtcagt atagattaat 540

aaattgtaat acctcagtca taacacaagc ctgtccaaag gtctcttttg acccaattcc 600

tatacattat tgtgctccag ctggttatgc gattctaaag tgtaataata agacattcac 660

tggaacagga ccgtgtaata atgtcagcac agtacaatgt acacatggaa ttaagccagt 720

ggtttcaact caactattgt taaatggtag cctagcagaa ggagagataa taattagatc 780

tgaaaatata acagacaatg tcaaaacaat aatagtacat ctcaatgaat ctgtaaagat 840

tgagtgtacg agacccaata ataaaacaag aacaagtata agaataggac caggacaagc 900

attttatgca acaggacaag taataggaga cataagagaa gcatattgta acattagtga 960

aagtaaatgg aatgaaactt tacaaagggt aagtaaaaaa ttaaaagaat acttccctca 1020

taagaatata acatttcaac catcctcagg aggggaccta gaaattacaa cacatagctt 1080

taattgtgga ggagaatttt tctattgcaa tacatcaagc ctgtttaata ggacatatat 1140

ggctaatagt acagaaacta acagtacacg aaccatcaca atccgctgca gaataaaaca 1200

aattataaac atgtggcagg aggtgggacg agcaatgtat gcccctccca ttgcaggaaa 1260

cataacatgt atatcaaata tcacaggact actattgaca agggatggag gaaaaaacaa 1320

tacggatacg gagacattca gacctggagg aggaaatatg aaggacaatt ggagaagtga 1380

attatataaa tataaagtgg tagaagttaa gccattagga gtagcaccca ctaatgcaag 1440

aaggagagtg gtggagagag aaaaaagagc agtgggaatg ggagctgtgt tccttgggtt 1500

cttgggagcg gcaggaagca ctatgggcgc agcatcaata acgctgacgg tacaggccag 1560

acaattattg tctggtatag tgcaacagca aagcaatttg ctgaaggcta tagaggctca 1620

acagcatatg ttgaaactca cggtctgggg cattaaacag ctccaggcaa gagtcctggc 1680

cttggaaaga tacctaaagg atcaacagct cctagggatg tggggctgct ctggaaaact 1740

catctgcacc actaatgtat attggaactc tagttggagt aataaaactt atggtgatat 1800

ttgggataac atgacctgga tgcagtggga gagagaaatt agcaattata cagaaataat 1860

atatgaattg cttgaagaat cacaaaacca gcaggaaaag aatgaacaag atttactagc 1920

attggacaga tggaacagtc tgtggaattg gtttaacata acaaattggc tgtggtatat 1980

aaaaatattc ataatgatag taggaggctt gataggttta agaataattt ttgctgtgct 2040

ttctttagta aatagagtta ggcagggata ctcacctctg tcgttacaga cccttatccc 2100

aagcccgagg ggaccagaca ggcccggagg aatcgaagaa gaaggtggag agcaagacag 2160

aaacagatca acgcgattag tgagcggatt cttagcgctt gtctgggacg acctgcggag 2220

cctgtgcctt ttcatctacc accgattgag agacttcata ttaattgcag cgagagcggg 2280

ggaacttctg ggacgcagca gtctcaaggg actacggaga ggatgggaag cccttaagta 2340

tctgggaagt cttgtgcagt attggggcct ggaactaaaa aggagtgcta ttagtctatt 2400

ggatacccta gcaatagcaa taggtgaagg aacagatagg attctagaat ttgtattagg 2460

aatttgtaga gctatccgca acatacctac aagaataaga cagggctttg aaacagcttt 2520

gctataa 2527

<210> SEQ ID NO 36

<211> LENGTH: 2574

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 36

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actaccaatg ctactgccag caatagcagt 420

ataatagagg gaatgaaaaa ttgctctttc aatataacca cagaattaag agataagaga 480

gagaaaaaga atgcactttt ttataaactt gatatagtac aactagatgg caactctagt 540

cagtatagat taataaattg taatacctca gtcataacac aagcctgtcc aaaggtctct 600

tttgacccaa ttcctataca ttattgtgct ccagctggtt atgcgattct aaagtgtaat 660

aataagacat tcactggaac aggaccgtgt aataatgtca gcacagtaca atgtacacat 720

ggaattaagc cagtggtttc aactcaacta ttgttaaatg gtagcctagc agaaggagag 780

ataataatta gatctgaaaa tataacaaac aatgccaaaa caataatagt acatctcaat 840

gaatctgtaa agattgagtg tacgagaccc aataataaaa caagaacaag tataagaata 900

ggaccaggac aagcatttta tgcaacagga caagtaatag gagacataag agaagcatat 960

tgtaacatta gtgaaagtaa atggaatgaa actttacaaa gggtaagtaa aaaattaaaa 1020

gaatacttcc ctcataagaa tataacattt caaccatcct caggagggga cctagaaatt 1080

acaacacata gctttaattg tggaggagaa tttttctatt gcaatacatc aagcctgttt 1140

aataggacat atatggctaa tagtacagat atggctaata gtacagaaac taacagtaca 1200

cgaatcatca caatccactg cagaataaaa caaattataa acatgtggca ggaggtggga 1260

cgagcaatgt atgcccctcc cattgcagga aacataacat gtatatcaaa tatcacagga 1320

ctactattga caagggatgg aggaaaaaac acaagggatg gaggaaaaaa caatacggag 1380

acattcagac ctggaggagg aaatatgaag gacaattgga gaagtgaatt atataaatat 1440

aaagtggtag aagttaagcc attaggagta gcacccacta atgcaagaag gagagtggtg 1500

gagagagaaa aaagagcagt gggaatggga gctgtgttcc ttgggttctt gggagcggca 1560

ggaagcacta tgggcgcagc atcaataacg ctgacggtac aggccagaca attattgtct 1620

ggtatagtgc aacagcaaag caatttgctg aaggctatag aggctcaaca gcatatgttg 1680

aaactcacgg tctggggcat taaacagctc caggcaagag tcctggcctt ggaaagatac 1740

ctaaaggatc aacagctcct agggatgtgg ggctgctctg gaaaactcat ctgcaccact 1800

aatgtatatt ggaactctag ttggagtaat aaaacttatg gtgatatttg ggataacatg 1860

acctggatgc agtgggagag agaaattagc aattatacag aaataatata tgaattgctt 1920

gaagaatcac aaaaccagca ggaaaagaat gaacaagatt tactagcatt ggacagatgg 1980

aacagtctgt ggaattggtt taacataaca aattggctgt ggtatataaa aatattcata 2040

atgatagtag gaggcttgat aggtttaaga ataatttttg ctgtgctttc tttagtaaat 2100

agagttaggc agggatactc acctctgtcg ttgcagaccc ttatcccaag cccgagggga 2160

ccagacaggc ccggaggaat cgaagaagaa ggtggagagc aagacagaaa cagatcaacg 2220

cgattagtga gcggattctt agcgcttgcc tgggacgacc tgcggagcct gtgccttttc 2280

atctaccacc gattgagaga cttcatatta attgcagcga gagcggggga acttctggga 2340

cgcagcagtc tcaagggact acggagagga tgggaagccc ttaagtatct gggaagtctt 2400

gtgcagtatt ggggcctgga actaaaaagg agtgctatta gtctattgga taccctagca 2460

atagcagtag gtgaaggaac agataggatt ctagaatttg tattaggaat ttgtagagct 2520

atccgcaaca tacctacaag aataagacag ggctttgaaa cagctttgct ataa 2574

<210> SEQ ID NO 37

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 37

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagacg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtta ctctaaactg taccaatgct actaatgcta ctgccagcaa tagcagtata 420

atagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac tagatggcaa ctccagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca ctggaacagg atcgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctgaaaatat aacagacaat ggcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccaat aataaaacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggag acataaaaga agcatattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtaaaaa attaaaagaa 1020

tacttccctc ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctaatag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

aacatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaaaaacaat acggatacgg agacattcag acctggagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agttggagta ataaaactta tggtgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac agaaataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cgttacagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg tctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag gatgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcaat aggtgaagga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 38

<211> LENGTH: 2559

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 38

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagacg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actaccaatg ctactgccag caatagcagt 420

ataatagagg gaatgaaaaa ttgctctttc aatataacca cagaattaag agataagaga 480

gagaaaaaga atgcactttt ttataaactt gatatagtac aactagatgg caactctagt 540

cagtatagat taataaattg taatacctca gtcataacac aagcctgtcc aaaggtctct 600

tttgacccaa ttcctataca ttattgtgct ccagctggtt atgcgattct aaagtgtaat 660

aataagacat tcactggaac aggaccgtgt aataatgtca gcacagtaca atgtacacat 720

ggaattaagc cagtggtttc aactcaacta ttgttaaatg gtagcctagc agaaggagag 780

ataataatta gatctgaaaa tataacaaac aatgccaaaa caataatagt acatctcaat 840

gaatctgtaa agattgagtg tacgagaccc agtaataaaa caagaacaag tataagaata 900

ggaccaggac aagcatttta tgcaacagga caagtaatag gagacataag agaagcatat 960

tgtaacatta gtgaaagtaa atggaatgaa actttacaaa gggtaagtaa aaaattaaaa 1020

gaatacttcc ctcataagaa tataacattt caaccatcct caggagggga cctagaaatt 1080

acaacacata gctttaattg tggaggagaa tttttctatt gcaatacatc aagcctgttt 1140

aataggacat atatggctaa tagtacagat atggctaata gtacagaaac taacagtaca 1200

cgaaccatca caatccgctg cagaataaaa caaattataa acatgtggca ggaggtggga 1260

cgagcaatgt atgcccctcc cattgcagga aacataacat gtatatcaaa tatcacagga 1320

ctactattga caagggatgg aggaaaaaac aatacggata cggagacatt cagacctgga 1380

ggaggaaata tgaaggacaa ttggagaagt gaattatata aatataaagt ggtagaagtt 1440

aagccattag gagtagcacc cactaatgca agaaggagag tggtggagag agaaaaaaga 1500

gcagtgggaa tgggagctgt gttccttggg ttcttgggag cggcaggaag cactatgggc 1560

gcagcatcaa taacgctgac ggtacaggcc agacaattat tgtctggtat agtgcaacag 1620

caaagcaatt tgctgaaggc tatagaggct caacagcata tgttgaaact cacggtctgg 1680

ggcattaaac agctccaggc aagagtcctg gccttggaaa gatacctaaa ggatcaacag 1740

ctcctaggga tgtggggctg ctctggaaaa ctcatctgca ccactaatgt atattggaac 1800

tctagttgga gtaataaaac ttatggtgat atttgggata acatgacctg gatgcagtgg 1860

gagagagaaa ttagcaatta tacagaaata atatatgaat tgcttgaaga atcacaaaac 1920

cagcaggaaa agaatgaaca agatttacta gcattggaca gatggaacag tctgtggaat 1980

tggtttaaca taacaaattg gctgtggtat ataaaagtat tcataatgat agtaggaggc 2040

ttgataggtt taagaataat ttttgctgtg ctttctttag taaatagagt taggcaggga 2100

tactcacctc tgtcgttaca gacccttatc ccaagcccga ggggaccaga caggcccgga 2160

ggaatcgaag aagaaggtgg agagcaagac agaaacagat caacgcgatt agtgagcgga 2220

ttcttagcgc ttgtctggga cgacctgcgg agcctgtgcc ttttcatcta ccaccgattg 2280

agagacttca tattaattgc agcgagagcg ggggaacttc tgggacgcag cagtctcaag 2340

ggactacgga gaggatggga agcccttaag tatctgggaa gtcttgtgca gtattggggc 2400

ctggaactaa aaaggagtgc tattagtcta ttggataccc tagcaataac agtaggtgaa 2460

ggaacagata ggattctaga atttgtatta ggaatttgta gagctatccg caacatacct 2520

acaagaataa gacagggctt tgaaacagct ttgctataa 2559

<210> SEQ ID NO 39

<211> LENGTH: 2559

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 39

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actaccaatg ctactgccag caatagcagt 420

ataatagagg gaatgaaaaa ttgctctttc aatataacca cagaattaag agataagaga 480

gagaaaaaga atgcactttt ttataaactt gatatagtac aactagatgg caactctagt 540

cagtatagat taataaattg taatacctca gtcataacac aagcctgtcc aaaggtctct 600

tttgacccaa ttcctataca ttattgtgct ccagctggtt atgcgattct aaagtgtaat 660

aataagacat tcactggaac aggaccgtgt aataatgtca gcacagtaca atgtacacat 720

ggaattaagc cagtggtttc aactcaacta ttgttaaatg gtagcctagc agaaggagag 780

ataataatta gatctgaaaa tataacaaac aatgccaaaa caataatagt acatctcaat 840

gaatctgtaa agattgagtg cacgagaccc aataataaaa caagaacaag tataagaata 900

ggaccaggac aagcatttta tgcaacagga caagtaatag gagacataag agaagcacat 960

tgtaacatta gtgaaagtaa atggaatgaa actttacaaa gggtaagtaa aaaattaaaa 1020

gaatacttcc ctcataagaa tataacattt caaccatcct caggagggga cctagaaatt 1080

acaacacata gctttaattg tggaggagaa tttttctatt gcaatacatc aagcctgttt 1140

aataggacat atatggctaa tagtacagat atggctaata gtacagaaac taacagtaca 1200

cgaaccatca caatccgctg cagaataaaa caaattataa acatgtggca ggaggtggga 1260

cgagcaatgt atgcccctcc cattgcagga aacataacat gtatatcaaa tatcacagga 1320

ctactattga caagggatgg aggaaaaaac aatacggata cggagacatt cagacctgga 1380

ggaggaaata tgaaggacaa ttggagaagt gaattatata aatataaagt ggtagaagtt 1440

aagccattag gagtagcacc cactaatgca agaaggagag tggtggagag agaaaaaaga 1500

gcagtgggaa tgggagctgt gttccttggg ttcttgggag cggcaggaag cactatgggc 1560

gcagcatcaa taacgctgac ggtacaggcc agacaattat tgtctggtat agtgcaacag 1620

caaagcaatt tgctgaaggc tatagaggct caacagcata tgttgaaact cacggtctgg 1680

ggcattaaac agctccaggc aagagtcctg gccttggaaa gatacctaaa ggatcaacag 1740

ctcctaggga tgtggggctg ctctggaaaa ctcatctgca ccactaatgt atattggaac 1800

tctagttgga gtaataaaac ttatggtgat atttgggata acatgacctg gatgcagtgg 1860

gagagagaaa ttagcaatta tacagaaata atatatgaat tgcttgaaga atcacaaaac 1920

cagcaggaaa agaatgaaca agatttacta gcattggaca gatggaacaa tctgtggaat 1980

tggtttaaca taacaaattg gctgtggtat ataaaaatat tcataatgat agtaggaggc 2040

ttgataggtt taagaataat ttttgctgtg ctttctttag taaatagagt taggcaggga 2100

tactcacctc tgtcgttgca gacccttatc ccaagcccga ggggaccaga caggcccgga 2160

ggaatcgaag aagaaggtgg agagcaagac agaaacagat caacgcgatt agtgagcgga 2220

ttcttagcgc ttgtctggga cgacctgcgg agcctgtgcc ttttcatcta ccaccgattg 2280

agagacttca tattaattgc agcgagagcg ggggaacttc tgggacgcag cagtctcaag 2340

ggactacgga gaggatggga agcccttaag tatctgggaa gtcttgtgca gtattggggc 2400

ctggaactaa aaaggagtgc tattagtcta ttggataccc tagcaatagc agtaggtgaa 2460

ggaacagata ggattctaga atttgtatta ggaatttgta gagctatccg caacatacct 2520

acaagaataa gacagggctt tgaaacagct ttgctataa 2559

<210> SEQ ID NO 40

<211> LENGTH: 2553

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 40

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actaccaatg ctactgccag caatagcagt 420

ataatagagg aaatgaaaaa ttgctctttc aatataacca cagaattaag agataagaga 480

gagaaaaaga atgcactttt ttataaactt gatatagtac aactagatgg caactctagt 540

cagtatagat taataaattg taatacctca gtcataacac aagcctgtcc aaaggtctct 600

tttgacccaa ttcctataca ttattgtgct ccagctggtt atgcgattct aaagtgtaat 660

aataagacat tcactggaac aggaccgtgt aataatgtca gcacagtaca atgtacacat 720

ggaattaagc cagtggtttc aactcaatta ttgttaaatg gtagcctagc agaaggagag 780

ataataatta gatctgaaaa tataacaaac actgccaaaa caataatagt acatctcaat 840

gaatctgtaa agattgagtg tacgagaccc aataataaaa caagaacaag tataagaata 900

ggaccaggac aagcatttta tgcaacagga caagtaatag gagacataag agaagcatat 960

tgtaacatta gtgaaagtaa atggaatgaa actttacaaa gggtaagtaa aaaattaaaa 1020

gaatacttcc ctcataagaa tataacattt caaccatcct caggagggga cctagaaatt 1080

acaacacata gctttaattg tggaggagaa tttttctatt gcaatacatc aagcctgttt 1140

aataggacat atatggctaa tagtacagat atggctaata gtacagaaac taacagtaca 1200

cgaaccatca caatccgctg cagaataaaa caaattataa acatgtggca ggaggtggga 1260

cgagcaatgt atgcccctcc cattgcagga aacataacat gtatatcaaa tatcacagga 1320

ctactattga caagggatgg aggagaaaac aatacggaga cattcagacc tggaggagga 1380

aatatgaagg acaattggag aagtgaatta tataaatata aagtggtaga agttaagcca 1440

ttaggagtag cacccactaa tgcaagaagg agagtggtgg agagagaaaa aagagcagtg 1500

ggaatgggag ctgtgttcct tgggttcttg ggagcggcag gaagcactat gggcgcagca 1560

tcaataacgc tgacggtaca ggccagacaa ttattgtctg gtatagtgca acagcaaagc 1620

aatttgctga aggctataga ggctcaacag catatgttga aactcacggt ctggggcatt 1680

aaacagctcc aggcaagagt cctggccttg gaaagatacc taaaggatca acagctccta 1740

gggatgtggg gctgctctgg aaaactcatc tgcaccacta atgtatattg gaactctagt 1800

tggagtaata aaacttatgg tgatatttgg gataacatga cctggatgca gtgggagaga 1860

gaaattagca attatacaga aataatatat gaattgcttg aagaatcaca aaaccagcag 1920

gaaaagaatg aacaagattt actagcattg gacagatgga acagtctgtg gaattggttt 1980

aacataacaa attggctgtg gtatataaaa atattcataa tgatagtagg aggcttgata 2040

ggtttaagaa taatttttgc tgtgctttct ttagtaaata gagttaggca gggatactca 2100

cctctgtcgt tgcagaccct tatcccaagc ccgaggggac cagacaggcc cggaggaatc 2160

gaagaagaag gtggagagca agacagaaac agatcaacgc gattagtgag cggattctta 2220

gcgcttgtct gggacgacct gcggagcctg tgccttttca tctaccaccg attgagagac 2280

ttcatattaa ttgcagcgag agcgggggaa cttctgggac gcagcagtct caagggacta 2340

cggagaggat gggaagccct taagtatctg ggaagtcttg tgcagtattg gggcctggaa 2400

ctaaaaagga gtgctattag tctattggat accctagcaa tagcagtagg tgaaggaaca 2460

gataggattc tagaatttgt attaggaatt tgtagagcta tccgcaacat acctacaaga 2520

ataagacagg gctttgaaac agctttgcta taa 2553

<210> SEQ ID NO 41

<211> LENGTH: 2553

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 41

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccaatg ctactgccag caatagcagt 420

ataatagagg gaatgaaaaa ttgctctttc aatataacca cagaattaag agataagaga 480

gagaaaaaga atgcactttt ttataaactt gatatagtac aactagatgg caactctagt 540

cagtatagat taataaattg taatacctca gtcataacac aagcctgtcc aaaggtctct 600

tttgacccaa ttcctataca ttattgtgct ccggctggtt atgcgattct aaagtgtaat 660

aataagacat tcactggaac aggaccgtgt aataatgtca gcacagtaca atgtacacat 720

ggaattaagc cagtggtttc aactcaacta ttgttaaatg gtagcctagc agaaggagag 780

ataataatta gatctgaaaa tataacaaac aatgccaaaa caataatagt acatctcaat 840

gaatctgtaa agattgagtg tacgagaccc aataataaaa caagaacaag tataagaata 900

ggaccaggac aagcatttta tgcaacagga caagtaatag gagacataag agaagcatat 960

tgtaacatta gtgaaagtaa atggaatgaa actttacaaa gggtaagtaa aaaattaaaa 1020

gaatacttcc ctcataagaa tataacattt caaccatcct caggagggga cctagaaatt 1080

acaacacata gctttaattg tggaggagaa tttttctatt gcaatacatc aagcctgttt 1140

aataggacat atatggctaa tagtacagat atggctaata gtacagaaac taacagtaca 1200

cgaatcatca caatccactg cagaataaaa caaattataa acatgtggca ggaggtggga 1260

cgagcaatgt atgcccctcc cattgcagga aacataacat gtatatcaaa tatcacagga 1320

ctactattga caagggatgg aggaaaaaac aatccggaga cattcagacc tggaggagga 1380

aatatgaagg acaattggag aagtgaatta tataaatata aagtggtaga agttaagcca 1440

ttaggagtag cacccactaa tgcaagaagg agagtggtgg agagagaaaa aagagcagtg 1500

ggtttgggag ctgtgttcct tgggttcttg ggagcggcag gaagcactat gggcgcagca 1560

tcaataacgc tgacggtaca ggccagacaa ttattgtctg gtatagtgca acagcaaagc 1620

aatttgctga aggctataga ggctcaacag catatgttga aactcacggt ctggggcatt 1680

aaacagctcc aggcaagagt cctggccttg gaaagatacc taaaggatca acagctccta 1740

gggatgtggg gttgctctgg aaaactcatc tgcaccacta atgtatattg gaactctagt 1800

tggagtaata aaacttatgg tgatatttgg gataacatga cctggatgca gtgggagaga 1860

gaaattagca attatacaga aataatatat gaattgcttg aagaatcaca aaaccagcag 1920

gaaaagaatg aacaagattt actagcattg gacagatgga acagtctgtg gaattggttt 1980

aacataacaa attggctgtg gtatataaaa atattcataa tgatagtagg aggcttgata 2040

ggtttaagaa taatttttgc tgtgctttct ttagtaaata gagttaggca gggatactca 2100

cctctgtcgt tgcagaccct tatcccaagc ccgaggggac cagacaggcc cggaggaatc 2160

gaagaagaag gtggagagca agacagaaac agatcaacgc gattagtgag cggattctta 2220

gcgcttgtct gggacgacct gcggagcctg tgccttttca tctaccaccg attgagagac 2280

ttcatattaa ttgcagcgag agcgggggaa cttctgggac gcagcagtct caagggacta 2340

cggagaggat gggaagccct taagtatctg ggaagtcttg tgcagtattg gggcctggaa 2400

ctaaaaagga gtgctattag tctattggat accctagcaa tagtagtagg tgaaggaaca 2460

gataggattc tagaatttgt attaggaatt tgtagagcta tccgcaacat acctacaaga 2520

ataagacagg gctttgaaac agctttgcta taa 2553

<210> SEQ ID NO 42

<211> LENGTH: 2559

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 42

atgagagtaa tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgaccccc 360

ctctgtgtca ctctaaactg taccaatgct actgccaatg ctactgccag caatagcagt 420

ataatagagg gaatgaaaaa ttgctctttc aatataacca cagaattaag agataagaga 480

gagaaaaaga atgcactttt ttataaactt gatatagtac aactagatgg caactctagt 540

cagtatagat taataaattg taatacctca gtcataacac aagcctgtcc aaaggtctct 600

tttgacccaa ttcctataca ttattgtgct ccagctggtt atgcgattct aaagtgtaat 660

aataagacat tcaatggaac aggaccgtgt aataatgtta gcacagtaca atgtacacat 720

ggaattaagc cagtggtttc aactcaacta ttgttaaatg gtagcctagc agaaggagag 780

ataataatta gatctgaaaa tataacaaac aatgtcaaaa caataatagt acatctcaat 840

gaatctgtaa agattgagtg tacgagaccc aataataaaa caagaacaag tataagaata 900

ggaccaggac aagcatttta tgcaacagga caagtaatag gagacataag agaagcacat 960

tgtaacatta gtgaaagtaa atggaataaa actttacaaa gggtaagtaa aaaattaaaa 1020

gaatacttcc ctcataagaa tataacattt caaccatcct caggagggga cctagaaatt 1080

acaacacata gctttaattg tggaggagaa tttttctatt gcaatacatc aagcctgttt 1140

aataggacat atatggctaa tagtacagat atggctaata gtacagaaac taacagtaca 1200

cgaaccatca caatccgctg cagaataaaa caaattataa acatgtggca ggaggtggga 1260

cgagcaatgt atgcccctcc cattgcagga aacataacat gtatatcaaa tatcacagga 1320

ctactattga caagggatgg aggaaaaaac aatacggata cggagacatt cagacctgga 1380

ggaggaaata tgaaggacaa ttggagaagt gaattatata aatataaagt ggtagaagtt 1440

aagccattag gagtagcacc cactaatgca agaaggagag tggtggagag agaaaaaaga 1500

gcagtgggaa tgggagctgt gttccttggg ttcttgggag cggcaggaag cactatgggc 1560

gcagcatcaa taacgctgac ggtacaggcc agacaattat tgtctggtat agtgcaacag 1620

caaagcaatt tgctgaaggc tatagaggct caacagcata tgttgaaact cacggtctgg 1680

ggcattaaac agctccaggc aagagtcctg gccttggaaa gatacctaaa ggatcaacag 1740

ctcctaggga tgtggggctg ctctggaaaa ctcatctgca ccactaatgt atattggaac 1800

tctagttgga gtaataaaac ttatggtgat atttgggata acatgacctg gatgcagtgg 1860

gagagagaaa ttagcaatta tacagaaata atatatgaat tgcttgaaga atcacaaaac 1920

cagcaggaaa agaatgaaca agatttacta gcattggaca gatggaacag tctgtggaat 1980

tggtttaaca taacaaattg gctgtggtat ataaaaatat tcataatgat agtaggaggc 2040

ttgataggtt taagaataat ttttgctgtg ctttctttag taaatagagt taggcaggga 2100

tactcacctc tgtcgttaca gacccttatc ccaagcccga ggggaccaga caggcccgga 2160

ggaatcgaag aagaaggtgg agagcaagac agaaacagat caacgcgatt agtgagcgga 2220

ttcttagcgc ttgtctggga cgacctgcgg agcctgtgcc ttttcatcta ccaccgattg 2280

agagacttca tattaattgc agcgagagcg ggggaacttc tgggacgcag cagtctcaag 2340

ggactacgga gaagatggga agcccttaag tatctgggaa gtcttgtgca gtattggggc 2400

ctggaactaa aaaggagtgc tattagtcta ttggataccc tagcaatagc aataggtgaa 2460

ggaacagata ggattctaga atttgtatta ggaatttgta gagctatccg caacatacct 2520

acaagaataa gacagggctt tgaaacagct ttgctataa 2559

<210> SEQ ID NO 43

<211> LENGTH: 2559

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 43

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgaccccc 360

ctctgtgtca ctctaaactg taccaatgct actgccaatg ctactgccag caatagcagt 420

ataatagagg gaatgaaaaa ttgctctttc aatataacca cagaattaag agataagaga 480

gagaaaaaga atgcactttt ttataaactt gatatagtac aactagatgg caactctagt 540

cagtatagat taataaattg taatacctca gtcataacac aagcctgtcc aaaggtctct 600

tttgacccaa ttcctataca ttattgtgct ccagctggtt atgcgattct aaagtgtaat 660

aataagacat tcaatggaac aggaccgtgt aataatgtca gcacagtaca atgtacacat 720

ggaattaagc cagtggtttc aactcaacta ttgttaaatg gtagcctagc agaaggagag 780

ataataatta gatctgaaaa tataacaaac aatgtcaaaa caataatagt acatctcaat 840

gaatctgtaa agattgagtg tacgagaccc aataataaaa caagaacaag tataagaata 900

ggaccaggac aagcatttta tgcaacagga caagtaatag gagacataag agaagcatat 960

tgtaacatta gtgaaagtaa atggaatgaa actttacaaa gggtaagtaa aaaattaaaa 1020

gaatacttcc ctcataagaa tataacattt caaccatcct caggagggga cctagaaatt 1080

acaacacata gctttaattg tggaggagaa tttttctatt gcaatacatc aagcctgttt 1140

aataggacat atatggctaa tagtacagat atggctaata gtacagaaac taacagtaca 1200

cgaaccatca aaatccactg cagaataaaa caaattataa acatgtggca ggaggtggga 1260

cgagcaatgt atgcccctcc cattgcagga aacataacat gtatatcaaa tatcacagga 1320

ctactattga caagggatgg aggaaaaaac aatacggata cggagacatt cagacctgga 1380

ggaggaaata tgaaggacaa ttggagaagt gaattatata aatataaagt ggtagaagtt 1440

aagccattag gagtagcacc cactaatgca agaaggagag tggtggagag agaaaaaaga 1500

gcagtgggaa tgggagctgt gttccttggg ttcttgggag cggcaggaag cactatgggc 1560

gcagcatcaa taacgctgac ggtacaggcc agacaattat tgtctggtat agtgcaacag 1620

caaagcaatt tgctgaaggc tatagaggct caacagcata tgttgaaact cacggtctgg 1680

ggcattaaac agctccaggc aagagtcctg gccttggaaa gatacctaaa ggatcaacag 1740

ctcctaggga tgtggggctg ctctggaaaa ctcatctgca ccactaatgt atattggaac 1800

tctagttgga gtaataaaac ttatggtgat atttgggata acatgacctg gatgcagtgg 1860

gagagagaaa ttagcaatta tacagaaata atatatgaat tgcttgaaga atcacaaaac 1920

cagcaggaaa agaatgaaca agatttacta gcattggaca gatggaacag tctgtggaat 1980

tggcttaaca taacaaattg gctgtggtat ataaaaatat tcataatgat agtaggaggc 2040

ttgataggtt taagaataat ttttgctgtg ctttctttag taaatagagt taggcaggga 2100

tactcacctc tgtcgttaca gacccttatc ccaagcccga ggggaccaga caggcccgga 2160

ggaatcgaag aagaaggtgg agagcaagac agaaacagat caacgcgatt agtgagcgga 2220

ttcttagcgc ttgtctggga cgacctgcgg agcctgtgcc ttttcatcta ccaccgattg 2280

agagacttca tattaattgc agcgagagcg ggggaacttc tgggacgcag cagtctcaag 2340

ggactacgga gaggatggga agcccttaag tatctgggaa gtcttgtgca gtattggggc 2400

ctggaactaa aaaggagtgc tattagtcta ttggataccc tagcaatagc agtaggtgaa 2460

ggaacagata ggattctaga atttgtatta ggaatttgta gagctatccg caacatacct 2520

acaagaataa gacagggctt tgaaacagct ttgctataa 2559

<210> SEQ ID NO 44

<211> LENGTH: 2559

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 44

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taacgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccaatg ctactgccag caatagcagt 420

ataatagagg gaatgaaaaa ttgctctttc aatataacca cagaattaag agataagaga 480

gagaaaaaga atgcactttt ttataaactt gatatagtac aactagatgg caactctagt 540

cagtatagat taataaattg taatacctca gtcataacac aagcctgtcc aaaggtctct 600

tttgacccaa ttcctataca ttattgtgct ccagctggtt atgcgattct aaagtgtaat 660

aataagacat tcactggaac aggaccgtgt aataatgtca gcacagtaca atgtacacat 720

ggaattaagc cagtggtttc aactcaacta ttgttaaatg gtagcctagc agaaggagag 780

ataataatta gatctgaaaa tataacaaac aatggcaaaa caataatagt acaactcaat 840

gaatctgtaa agattgagtg tacgagaccc aataataaaa caagaacaag tataagaata 900

ggaccaggac aagcatttta tgcaacagga caagtaatag gaaacataag agaagcatat 960

tgtaacatta gtgaaagtaa atggaatgaa actttacaaa gggtaagtaa aaaattaaaa 1020

gaatacttcc ctcataagaa tataacattt caaccatcct caggagggga cctagaaatt 1080

acaacacata gctttaattg tggaggagaa tttttctatt gcaatacatc aagcctgttt 1140

aataggacat atatggctaa tagtacagat atggctaata gtacagaaac taacagtaca 1200

cgaatcatca caatccactg cagaataaaa caaattataa acatgtggca ggaggtggga 1260

cgagcaatgt atgcccctcc cattgcagga aacataacat gtatatcaaa tatcacagga 1320

ctactattga caagggatgg aggaaaaaac aatacggata cggagacatt cagacctgga 1380

ggaggaaata tgaaggacaa ttggagaagt gaattatata aatataaagt ggtagaagtt 1440

aagccattag gagtagcacc cactaatgca agaaggagag tggtggagag agaaaaaaga 1500

gcagtgggaa tgggagctgt gttccttggg ttcttgggag cggcaggaag cactatgggc 1560

gcagcatcaa taacgctgac ggtacaggcc agacaattat tgtctggtat agtgcaacag 1620

caaagcaatt tgctgaaggc tatagaggct caacagcata tgttgaaact cacggtctgg 1680

ggcattaaac agctccaggc aagagtcctg gccttggaaa gatacctaaa ggatcaacag 1740

ctcctaggga tgtggggctg ctctggaaaa ctcatctgca ccactaatgt atattggaac 1800

tctagttgga gtaataaaac ttatggtgat atttgggata acatgacctg gatgcagtgg 1860

gagagagaaa ttagcaatta tacagaaata atatatgaat tgcttgaaga atcacaaaac 1920

cagcaggaaa agaatgaaca agatttacta gcattggaca gatggaacag tctgtggaat 1980

tggtttaaca taacaaattg gctgtggtat ataaaaatat tcataatgat agtaggaggc 2040

ttgataggtt taagaataat ttttgctgtg ctttctttag taaatagagt taggcaggga 2100

tactcacctc tgtcgttgca gacccttatc ccaagcccga ggggaccaga caggcccgga 2160

ggaatcgaag aagaaggtgg agagcaagac agaaacagat caacgcgatt agtgagcgga 2220

ttcttagcgc ttgtctggga cgacctgcgg agcctgtgcc ttttcatcta ccaccgattg 2280

agagacttca tattaattgc agcgagagcg ggggaacttc tgggacgcag cagtctcaag 2340

ggactacgga gaggatggga agcccttaag tatctgggaa gtcttgtgca gtattggggc 2400

ctggaactaa aaaggagtgc tattagtcta ttggataccc tagcaatagc agtaggtgaa 2460

ggaacagata ggattctaga atttgtatta ggaatttgta gagctatccg caacatacct 2520

acaagaataa gacagggctt tgaaacagct ttgctataa 2559

<210> SEQ ID NO 45

<211> LENGTH: 2562

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 45

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atgctactgc cagcaatagc 420

agtataatag agggaatgaa aaattgctct ttcaatataa ccacagaatt aagagataag 480

agagagaaaa agaatgcact tttttataaa cttgatatag tacaactaga tggcaactct 540

agtcagtata gattaataaa ttgtaatacc tcagtcataa cacaagcctg tccaaaggtc 600

tcttttgacc caattcctat acattattgt gctccagctg gttatgcgat tctaaagtgt 660

aataataaga cattcactgg aacaggaccg tgtaataatg tcagcacagt acaatgtaca 720

catggaatta agccagtggt ttcaactcaa ctattgttaa atggtagcct agcagaagga 780

gagataataa ttagatctga aaatataaca aacaatgtca aaacaataat agtacatctc 840

aatgaatctg taaagattga gtgtacgaga cccaataata aaacaagaac aagtataaga 900

ataggaccag gacaagcatt ttatgcaaca ggacaagtaa taggaaacat aagagaagca 960

tattgtaaca ttagtgaaag taaatggaat gaaactttac aaagggtaag taaaaaatta 1020

aaagaatact tccctcataa gaatataaca tttcaaccat cctcaggagg ggacctagaa 1080

attacaacac atagctttaa ttgtggagga gaatttttct attgcaatac atcaagcctg 1140

tttaatagga catatatggc taatagtaca gatatggcta atagtacaga aactaacagt 1200

acacgaatca tcacaatcca ctgcagaata aaacaaatta taaacatgtg gcaggaggtg 1260

ggacgagcaa tgtatgcccc tcccattgca ggaaacataa catgtatatc aaatatcaca 1320

ggactactat tgacaaggga tggaggaaaa aacaatacgg atacggagac attcagacct 1380

ggaggaggaa atatgaagga caattggaga agtgaattat ataaatataa agtggtagaa 1440

gttaagccat taggagtagc acccactaat gcaagaagga gagtggtgga gagagaaaaa 1500

agagcagtgg gaatgggagc tgtgttcctt gggttcttgg gagcggcagg aagcactatg 1560

ggcgcagcat caataacgct gacggtacag gccagacaat tattgtctgg tatagtgcaa 1620

cagcaaagca atttgctgaa ggctatagag gctcaacagc atatgttgaa actcacggtc 1680

tggggcatta aacagctcca ggcaagagtc ctggccttgg aaagatacct aaaggatcaa 1740

cagctcctag ggatgtgggg ctgctctgga aaactcatct gcaccactaa tgtatattgg 1800

aactctagtt ggagtaataa aacttatggt gatatttggg ataacatgac ctggatgcag 1860

tgggagagag aaattagcaa ttatacagaa ataatatatg aattgcttga agaatcacaa 1920

aaccagcagg aaaagaatga acaagattta ctagcattgg acagatggaa cagtctgtgg 1980

aattggttta acataacaaa ttggctgtgg tatataaaaa tattcataat gatagtagga 2040

ggcttgatag gtttaagaat aatttttgct gtgctttctt tagtaaatag agttaggcag 2100

ggatactcac ctctgtcgtt acagaccctt atcccaagcc cgaggggacc agacaggccc 2160

ggaggaatcg aagaagaagg tggagagcaa gacagaaaca gatcaacgcg attagtgagc 2220

ggattcttag cgcttgtctg ggacgacctg cggagcctgt gccttttcat ctaccaccga 2280

ttgagagact tcatattaat tgcagcgaga gcgggggaac ttctgggacg cagcagtctc 2340

aagggactac ggagaggatg ggaagccctt aagtatctgg gaagtcttgt gcagtattgg 2400

ggcctggaac taaaaaggag tgctattagt ctattggata ccctagcaat agcagtaggt 2460

gaaggaacag ataggattct agaatttgta ttaggaattt gtagagctat ccgcaacata 2520

cctacaagaa taagacaggg ctttgaaaca gctttgctat aa 2562

<210> SEQ ID NO 46

<211> LENGTH: 2562

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 46

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atgctactgc cagcaatagc 420

agcataatag agggaatgaa aaattgctct ttcaatataa ccacagaatt aagagataag 480

agagagaaaa agaatgcact tttttataaa cttgatatag tacaactaga tggcaactct 540

agtcagtata gattaataaa ttgtaatacc tcagtcataa cacaagcctg tccaaaggtc 600

tcttttgacc caattcctat acattattgt gctccagctg gttatgcgat tctaaagtgt 660

aataataaga cattcactgg aacaggaccg tgtaataatg tcagcacagt acaatgtaca 720

catggaatta agccagtggt ttcaactcaa ctattgttaa atggtagcct agcagaagga 780

gagataataa ttagatctga aaatataaca aacaatggca aaacaataat agtacatctc 840

aatgaatctg taaagattga gtgtacgaga cccagtaata aaacaagaac aagtataaga 900

ataggaccag gacaagcatt ttatgcaaca ggacaagtaa taggagacat aagagaagca 960

cattgtaaca ttagtgaaag taaatggaat gaaactttac aaagggtaag taaaaaatta 1020

aaagaatact tccctcataa gaatataaca tttcaaccat cctcaggagg ggacctagaa 1080

attacaacac atagctttaa ttgtggagga gaatttttct attgcaatac atcaagcctg 1140

tttaatagga catatatggc taatagtaca gatatggcta atagtacaga aactaacagt 1200

acacgaacca tcacactcca ctgcagaata aaacaaatta taaacatgtg gcaggaggtg 1260

ggacgagcaa tgtatgcccc tcccattgca ggaaacataa catgtatatc aaatatcaca 1320

ggactactat tgacaaggga tggaggaaaa aacaatacgg atacggagac attcagacct 1380

ggaggaggaa atatgaagga caattggaga agtgaattat ataaatataa agtggtagaa 1440

gttaagccat taggagtagc acccactaat gcaagaagga gagtggtgga gagagaaaaa 1500

agagcagtgg gaatgggagc tgtgttcctt gggttcttgg gagcggcagg aagcactatg 1560

ggcgcagcat caataacgct gacggtacag gccagacaat tattgtctgg tatagtgcaa 1620

cagcaaagca atttgctgaa ggctatagag gctcaacagc atatgttgaa actcacggtc 1680

tggggcatta aacagctcca ggcaagagtc ctggccttgg aaagatacct aaaggatcaa 1740

cagctcctag ggatgtgggg ctgctctgga aaactcatct gcaccactaa tgtatattgg 1800

aactctagtt ggagtaataa aacttatggt gatatttggg ataacatgac ctggatgcag 1860

tgggagagag aaattagcaa ttatacagaa ataatatatg aattgcttga agaatcacaa 1920

aaccagcagg aaaagaatga acaagattta ctagcattgg acagatggaa cagtctgtgg 1980

aattggttta acataacaaa ttggctgtgg tatataaaaa tattcataat gatagtagga 2040

ggcttgatag gtttaagaat aatttttgct gtgctttctt tagtaaatag agttaggcag 2100

ggatactcac ctctgtcgtt acagaccctt atcccaagcc cgaggggacc agacaggccc 2160

ggaggaatcg aagaagaagg tggagagcaa gacagaaaca gatcaacgcg attagtgagc 2220

ggattcttag cgcttgtctg ggacgacctg cggagcctgt gccttttcat ctaccaccga 2280

ttgagagact tcatattaat tgcagcgaga gcgggggaac ttctgggacg cagcagtctc 2340

aagggactac ggagaggatg ggaagccctt aagtatctgg gaagtcttgt gcagtattgg 2400

ggcctggaac taaaaaggag tgctattagt ctattggata ccctagcaat agcagtaggt 2460

gaaggaacag ataggattct agaatttgta ttaggaattt gtagagctat ccgcaacata 2520

cctacaagaa taagacaggg ctttgaaaca gctttgctat aa 2562

<210> SEQ ID NO 47

<211> LENGTH: 2562

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 47

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

ggtttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atgctactgc cagcaatagc 420

agtataatag agggaatgaa aaattgctct ttcaatataa ccacagaatt aagagataag 480

agagagaaaa agaatgcact tttttataaa cttgatatag tacaactaga tggcaactct 540

agtcagtata gattaataaa ttgtaatacc tcagtcataa cacaagcctg tccaaaggtc 600

tcttttgacc caattcctat acattattgt gctccagctg gttatgcgat tctaaagtgt 660

aataataaga cattcactgg aacaggaccg tgtaataatg tcagcacagt acaatgtaca 720

catggaatta agccagtggt ttcaactcaa ctattgttaa atggtagcct agcagaagga 780

gagataataa ttagatctga aaatataaca aacaatggca aaacaataat agtacatctc 840

aatgaatctg taaagattga gtgtacgaga cccaataata aaacaagaac aagtataaga 900

ataggaccag gacaagcatt ttatgcaaca ggacaagtaa taggagacat aagagaagca 960

cattgtaaca ttagtgaaag taaatggaat gaaactttac aaagggtaag taaaaaatta 1020

aaagaatact tccctcatca gaatataaca tttcaaccat cctcaggagg ggacctagaa 1080

attacaacac atagctttaa ttgtggagga gaatttttct attgcaatac atcaagcctg 1140

tttaatagga catatatggc taatagtaca gatatggcta atagtacaga aactaacagt 1200

acacgaacca tcacaatccg ctgcagaata aaacaaatta taaacatgtg gcaggaggtg 1260

ggacgagcaa tgtatgcccc tcccattgca ggaaacataa catgtatatc aaatatcaca 1320

ggactactat tgacaaggga tggaggaaaa aacaatacgg atacggagac attcagacct 1380

ggaggaggaa atatgaagga caattggaga agtgaattat ataaatataa agtggtagaa 1440

gttaagccat taggagtagc acccactaat gcaagaagga gagtggtgga gagagaaaaa 1500

agagcagtgg gaatgggagc tgtgttcctt gggttcttgg gagcggcagg aagcactatg 1560

ggcgcagcat caataacgct gacggtacag gccagacaat tattgtctgg tatagtgcaa 1620

cagcaaagca atttgctgaa ggctatagag gctcaacagc atatgttgaa actcacggtc 1680

tggggcatta aacagctcca ggcaagagtc ctggccttgg aaagatacct aaaggatcaa 1740

cagctcctag ggatgtgggg ctgctctgga aaactcatct gcaccactaa tgtatattgg 1800

aactctagtt ggagtaataa aacttatggt gatatttggg ataacatgac ctggatgcag 1860

tgggagagag aaattagcaa ttatacagaa ataatatatg aattgcttga agaatcacaa 1920

aaccagcagg aaaagaatga acaagattta ctagcattgg acagatggaa cagtctgtgg 1980

aattggttta acataacaaa ttggctgtgg tatataaaaa tattcataat gatagtagga 2040

ggcttgatag gtttaagaat aatttttgct gtgctttctt tagtaaatag agttaggcag 2100

ggatactcac ctctgtcgtt acagaccctt atcccaagcc cgaggggacc agacaggccc 2160

ggaggaatcg aagaagaagg tggagagcaa gacagaaaca gatcaacgcg attagtgagc 2220

ggattcttag cgcttgtctg ggacgacctg cggagcctgt gccttttcat ctaccaccga 2280

ttgagagact tcatattaat tacagcgaga gcgggggaac ttctgggacg cagcagtctc 2340

aagggactac ggagaggatg ggaagccctt aagtatctgg gaagtcttgt gcagtattgg 2400

ggcctggaac taaaaaggag tgctattagt ctattggata ccctagcaat agcagtaggt 2460

gaaggaacag ataggattct agaatttgta ttaggaattt gtagagctat ccgcaacata 2520

cctacaagaa taagacaggg ctttgaaaca gctttgctat aa 2562

<210> SEQ ID NO 48

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 48

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actaccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgacaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataacaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattagt 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aatcatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgtta 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag cgttgctata a 2541

<210> SEQ ID NO 49

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 49

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gatgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccatca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgacaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcacattg taacattagt 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccgctgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttaga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

agttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 50

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 50

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gatgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccatca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgacaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattagt 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acggaaacta acaatacacg acccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggaatagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttaga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 51

<211> LENGTH: 2565

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 51

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagaa actgtaccaa tgctactgcc 420

agcaatagca gtataataga gggaatgaaa aattgctctt tcaatataac cacagaatta 480

agagataaga gagagaaaaa gaatgcactt ttttataaac ttgatatagt acaactagat 540

ggcaactcta gtcagtatag attaataaat tgtaatacct cagtcataac acaagcctgt 600

ccaaaggtct cttttgaccc aattcctata cattattgtg ctccagctgg ttatgcgatt 660

ctaaagtgta ataataagac attcactgga acaggaccgt gtaataatgt cagcacagta 720

caatgtacac atggaattaa gccagtggtt tcaactcaac tattgttaaa tggtagccta 780

gcagaaggag agataataat tagatctgaa aatataacaa acagtggcaa aacaataata 840

gtacatctca atgaatctgt aaagattgag tgtacgagac ccaataataa aacaagaaca 900

agtataagaa taggaccagg acaagcattt tatgcaacag gacaagtaat aggagacata 960

agagaagcat attgtaacat tagtgaaagt aaatggaatg aaactttaca aagggtaagt 1020

aaaaaattaa aagaatactt ccctcataag aatataacat ttcaaccatc atcaggaggg 1080

gacctagaaa ttacaacaca tagctttaat tgtggaggag aatttttcta ttgcaataca 1140

tcaagcctgt ttaataggac atatatggct aatagtacag atatggctaa tagtacagaa 1200

actaacagta cacgaatcat cacaatccac tgcagaataa aacaaattat aaacatgtgg 1260

caggaggtgg gacgagcaat gtatgcccct cccattgcag gaaacataac atgtatatca 1320

agtatcacag gactactatt gacaagggat ggaggagaaa acaatacgga gacattcaga 1380

cctggaggag gaaatatgaa ggacaattgg agaagtgaat tatataaata taaagtggta 1440

gaagttaagc cattaggagt agcacccact aatgcaagaa ggagagtggt ggagagagaa 1500

aaaagagcag tgggaatggg agctgtgttc cttgggttct tgggagcggc aggaagcact 1560

atgggcgcag catcaataac gctgacggta caggccagac aattattgtc tggtatagtg 1620

caacagcaaa gcaatttgct gaaggctata gaggctcaac agcatatgtt gaaactcacg 1680

gtctggggca ttaaacagct ccaggcaaga gtcctggcct tggaaagata cctaaaggat 1740

caacagctcc tagggatgtg gggctgctct ggaaaactca tctgcaccac taatgtatat 1800

tggaactcta gttggagtaa taaaacttat ggtgatattt gggataacat gacctggatg 1860

cagtgggaga gagaaattag caattataca gaaataatat atgaattgct tgaagaatca 1920

caaaaccagc aggaaaagaa tgaacaagat ttactagcat tggacagatg gaacagtctg 1980

tggaattggt ttaacataac aaattggctg tggtatataa aaatattcat aatgatagta 2040

ggaggcttga taggtttaag aataattttt gctgtgtttt ctttagtaaa tagagttagg 2100

cagggatact cacctctatc gttgcagacc cttatcccaa gcccgagggg accagacagg 2160

cccggaggaa tcgaagaaga aggtggagag caagacagaa acagatcaac gcgattagtg 2220

agcggattct tagcgcttgt ctgggacgac ctgcggagcc tgtgcctttt catctaccac 2280

cgattgagag acttcatatt aattgcagcg agagcggggg aacttctggg acgcagcagt 2340

ctcaagggac tacggagagg atgggaagcc cttaagtatc tgggaagtct tgtgcagtat 2400

tggggcctgg aactaaaaag gagtgctatt agtctattgg ataccctagc aatagcagta 2460

ggtgaaggaa cagataggat tctagaattt gtattaggaa tttgtagagc tatccgcaac 2520

atacctacaa gaataagaca gggctttgaa acagctttgc tataa 2565

<210> SEQ ID NO 52

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 52

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actaatgcta ctgccagcaa tagcagtata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac tagatggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctgaaaatat aacagacaat ggcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggag acataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtaaaaa attaaaagaa 1020

tacttccctc ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctaatag tacagaaact aacagtacac gaaccatcac actccactgc 1200

agaataaaac aaattataaa catgtggcag gaggtgggac gagcaatgta tgcccctccc 1260

attgcaggaa acataacatg tatatcaaat atcacaggac tactattgac aagggatgga 1320

ggaaaaaaca atacggagac attcgagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cctactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggt 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgcctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagagggtgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 53

<211> LENGTH: 2547

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 53

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct actgccagca atgctactgc catcaatagc 420

agtataatag agggaatgaa aaattgctct ttcaatataa ccacagaatt aagagataag 480

agagagaaaa agaatgcact tttttataaa cttgatatag tacaactaga tggcaactct 540

agtcagtata gattaataaa ttgtaatacc tcagtcataa cacaagcctg tccaaaggtc 600

tcttttgacc caattcctat acattattgt gctccagctg gttatgcgat tctaaagtgt 660

aataataaga cattcaatgg aacaggaccg tgtaataatg tcagcacagt acaatgtaca 720

catggaatta agccagtggt ttcaactcaa ctattgttaa atggtagcct agcagaagga 780

gagataataa ttagatctga aaatataaca aacaatgcca aaacaataat agtacatctc 840

aatgaatctg taaagattga gtgtacgaga cccagtaata acacaagaac aagtataaga 900

ataggaccag gacaagcatt ttatgcaaca ggacaagtaa taggagacat aagagaagca 960

cattgtaaca ttagtgaaag taaatggaat gaaactttac aaagggtaag taaaaaatta 1020

aaagaatact tccctcataa gaatataaca tttcaaccat cctcaggagg ggacctagaa 1080

attacaacac atagctttaa ttgtggagga gaatttttct attgcaatac atcaagcctg 1140

tttaatagga catatatggc taatagtaca gaaactaaca gtacacgaat catcacaatc 1200

cgctgcagaa taaaacaaat tataaacatg tggcaggagg tgggacgagc aatgtatgcc 1260

cctcccattg caggaaacat aacatgtata tcaaatatca caggactact attgacaagg 1320

gatggaggaa aaaacaatac ggagacattc gagacattca gacctgaagg aggaaatatg 1380

aaggacaatt ggagaagtga attatataaa tataaagtgg tagaagttaa gccattagga 1440

gtagcaccca ctaatgcaag aaggagagtg gtggagagag aaaaaagagc agtgggaatg 1500

ggagctgtgt tccttgggtt cttgggagcg gcaggaagca ctatgggcgc agcatcaata 1560

acgctgacgg tacaggccag acaattattg tctggtatag tgcaacagca aagcaatttg 1620

ctgaaggcta tagaggctca acagcatatg ttgaaactca cggtctgggg cattaaacag 1680

ctccaggcaa gagtcctggc cttggaaaga tacctaaagg atcaacagct cctagggatg 1740

tggggctgct ctggaaaact catctgcacc actaatgtat attggaactc tagttggagt 1800

aataaaactt atggtgatat ttgggataac atgacctgga tgcagtggga gagagaaatt 1860

agcaattata cagaaataat atatgaattg cttgaagaat cacaaaacca gcaggaaaag 1920

aatgaacaag atttactagc attggacaga tggaacagtc tgtggaattg gtttaacata 1980

acaaattggc tgtggtatat aaaaatattc ataatgatag taggaggctt gataggttta 2040

agaataattt ttgctgtgct ttctttagta aatagagtta ggcagggata ctcacctctg 2100

tcattgcaga cccttatccc aagcccgagg ggaccagaca gacccggagg aatcgaagaa 2160

gaaggtggag agcaagacag aaacagatca acgcgattag tgagcggatt cttagcgctt 2220

gcctgggacg acctgcggag cctgtgcctt ttcatctacc accgattgag agacttcata 2280

ttaattgcag cgagagcggg ggaacttctg ggacgcagca gtctcaaggg actacggaga 2340

ggatgggaag cccttaagta tctgggaagt cttgtgcagt attggggcct ggaactaaaa 2400

agaagtgcta ttagtctatt ggatacccta gcaatagcag taggtgaagg aacagatagg 2460

attctagaat ttgtattagg aatttgtaga gctatccgca acatacctac aagaataaga 2520

cagggctttg aaacagcttt gctataa 2547

<210> SEQ ID NO 54

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 54

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tttattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttaacccca 360

ctctgtgtca ctctaaactg taccaatgct actaatgcta ctgccagcaa tagcagtata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac tagatggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tactcatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctgaaaatat aacagacaat ggcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggag acataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtaaaaa attaaaagaa 1020

tacttccctc ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctaatag tacagaaact aacagtacac gaaccatcac aatccgctgc 1200

agaataaaac aaattataaa catgtggcag gaggtgggac gagcaatgta tgcccctccc 1260

attgcaggaa acataacatg tatatcaaat atcacaggac tactattgac aagggatgga 1320

ggagaaaaca atacggagac attcgagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agcggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttagg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgcctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

aaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 55

<211> LENGTH: 2580

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 55

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt agatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct actgccagca atgctactgc cagcaatgct 420

actgccagca atagcagtat aatagaggga atgaaaaatt gctctttcaa tataaccaca 480

gaattaagag ataagagaga gaaaaagaat gcactttttt ataaacttga tatagtacaa 540

ctagatggca actctagtca gtatagatta ataaattgta atacctcagt cataacacaa 600

gcctgtccaa aggtctcttt tgacccaatt cctatacatt attgtgctcc agctggttat 660

gcgattctaa agtgtaataa caagacattc aatggaacag gaccgtgtaa taatgtcagc 720

acagtacaat gtacacatgg aattaagcca gtggtttcaa ctcaactatt gttaaatggt 780

agcctagcag aaggagagat aataattaga tctgaaaata taacagacaa tggcaaaaca 840

ataatagtac atctcaatga atctgtaaag attgagtgta cgagacccag taataacaca 900

agaacaagta taagaatagg accaggacaa gcattttatg caacaggaca agtaatagga 960

gacataagag aagcacattg taacattagt gaaaataaat ggaatgaaac tttacaaagg 1020

gtaagtaaaa aattaaaaga atacttccct cataagaata taacatttca accatcctca 1080

ggaggggacc tagaaattac aacacatagc tttaattgtg gaggagaatt tttctattgc 1140

aatacatcaa gcctgtttaa taggacatat atggctaata gtacagatat ggctaatagt 1200

acagaaacta acagtacacg aaccatcaca atccgctgca gaataaaaca aattataaac 1260

atgtggcagg aggtgggacg agcaatgtat gcccctccca ttgcaggaaa cataacatgt 1320

atatcaaata tcacaggact actattgaca agggatggag gaaaaaacaa tacggagaca 1380

ttcgagacat tcagacctgg aggaggaaat atgaaggaca attggagaag tgaattatat 1440

aaatataaag tggtagaagt taagccatta ggagtagcac ccactaatgc aagaaggaga 1500

gtggtggaga gagaaaaaag agcagtggga atgggagctg tgttccttgg gttcttggga 1560

gcggcaggaa gcactatggg cgcagcatca ataacgctga cggtacaggc cagacaatta 1620

ttgtctggta tagtgcaaca gcaaagcaat ttgctgaagg ctatagaggc tcaacagcat 1680

atgttgaaac tcacggtctg gggcattaaa cagctccagg caagagtcct ggccttggaa 1740

agatacctaa aggatcaaca gctcctaggg atgtggggct gctctggaaa actcatctgc 1800

accactaatg tatattggaa ctctagttgg agtaataaaa cttatggtga tatttgggat 1860

aacatgacct ggatgcagtg ggagagagaa attagcaatt atacagaaat aatatatgaa 1920

ttgcttgaag aatcacaaaa ccagcaggaa aagaatgaac aagatttact agcattggac 1980

agatggaaca gtctgtggaa ttggtttaac ataacaaatt ggctgtggta tataaaaata 2040

ttcataatga tagtaggagg cttgataggt ttaagaataa tttttgctgt gctctcttta 2100

gtaaatagag ttaggcaggg atactcacct ctgtcattgc agacccttat cccaagcccg 2160

aggggaccag acaggcccgg aggaatcgaa gaagaaggtg gagagcaaga cagaaagaga 2220

tcaacgcgat tagtgagcgg attcttagcg cttgtctggg acgacctgcg gagcctgtgc 2280

cttttcatct accaccgatt gagagacttc atattaattg cagcgagagc gggggaactt 2340

ctgggacgca gcagtctcaa gggactacgg agaggatggg aagcccttaa gtatctggga 2400

agtcttgtgc agtattgggg cctggaacta aaaaggagtg ctattagtct attggatacc 2460

ctagcaatag cagtaggtga aggaacagat aggattctag aatttgcatt aggaatttgt 2520

agagctatcc gcaacatacc tacaagaata agacagggct ttgaaacagc tttgctataa 2580

<210> SEQ ID NO 56

<211> LENGTH: 2553

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 56

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt agatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct actgccagca atgctactgc cagcaatgct 420

actgccagca atagcagtat aatagaggga atgaaaaatt gctctttcaa tataaccaca 480

gaattaagag ataagagaga gaaaaagaat gcactttttt ataaacttga tatagtacaa 540

ctagatggca actctagtca gtatagatta ataaattgta atacctcagt cataacacaa 600

gcctgtccaa aggtctcttt tgacccaatt cctatacatt attgtgctcc agctggttat 660

gcgattctaa agtgtaataa taagacattc aatggaacag gaccgtgtaa taatgtcagc 720

acagtacaat gtacacatgg aattaagcca gtggtttcaa ctcaactatt gttaaatggt 780

agcctagcag aaggagagat aataattaga tctgaaaata taacagacaa tggcaaaaca 840

ataatagtac atctcaatga atctgtaaag attgagtgta cgagacccag taataacaca 900

agaacaagta taagaatagg accaggacaa gcattttatg caacaggaca agtaatagga 960

gacataagag aagcacattg taacattagt gaaagtaaat ggaatgaaac tttacaaagg 1020

gtaagtaaaa aattaaaaga atacttccct cataagaata taacatttca accatcctca 1080

ggaggggacc tagaaattac aacacatagt tttaattgtg gaggagaatt tttctattgc 1140

aatacatcaa gcctgtttaa taggacatat atggctaata gtacagaaac taacagtaca 1200

cgaatcatca caatccgctg cagaataaaa caaattataa acatgtggca ggaggtggga 1260

agagcaatgt atgcccctcc cattgcagga aacataacat gtatatcaaa tatcacagga 1320

ctactattga caagggatgg aggaaataac aatacggaga cattcagacc tggaggagga 1380

aatatgaagg acaattggag aagtgaatta tataaatata aagtggtaga agttaagcca 1440

ttaggagtag cacccactaa tgcaagaagg agagtggtgg agagagaaaa aagagcagtg 1500

ggaatgggag ctgtgttcct tgggttcttg ggagcggcag gaagcactat gggcgcagca 1560

tcaataacgc tgacggtaca ggccagacaa ttattgtctg gtatagtgca acagcaaagc 1620

aatttgctga aggctatagg ggctcaacag catatgttga aactcacggt ctggggcatt 1680

aaacagctcc aggcaagagt cctggccttg gaaagatacc taaaggatca acagctccta 1740

gggatgtggg gctgctctgg aaaactcatc tgcaccacta atgtatattg gaactctagt 1800

tggagtaata aaacttatgg tgatatttgg gataacatga cctggatgca gtgggagaga 1860

gaaattagca attatacaga aatgatatat gaattgcttg aagaatcaca aaaccagcag 1920

gaaaagaatg aacaagattt actagcattg gacagatgga acagtctgtg gaattggttt 1980

aacataacaa attggctgtg gtatataaaa atattcataa tgatagtagg aggcttgata 2040

ggtttaagaa taatttttgc tgtgctctct ttagtaaata gagttaggca gggatactca 2100

cctctgtcat tgcagaccct tatcccaagc ccgaggggac cagacaggcc cggaggaatc 2160

gaagaagaag gtggagagca agacagaaag agatcaacgc gattagtgag cggattctta 2220

gcgcttgtct gggacgacct gcggagcctg tgccttttca tctaccaccg attgagagac 2280

ttcatattaa ttgcagcgag agcgggggaa cttctgggac gcagcagtct caagggacta 2340

cggagaggat gggaagccct taagtatctg ggaagtcttg tgcagtattg gggcctggaa 2400

ctaaaaagga gtgctattag tctattggat accctagcaa tagcagtagg tgaaggaaca 2460

gataggattc tagaatttgc attaggaatt tgtagagcta tccgcaacat acctacaaga 2520

ataagacagg gctttgaaac agctttgcta taa 2553

<210> SEQ ID NO 57

<211> LENGTH: 2580

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 57

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct aatgctactg ccagcaatag cagtataata 420

gagggaatga atagcagtat aatagaggga atgaaaaatt gctctttcaa tataaccaca 480

gaattaagag ataagagaga gaaaaagaat gcactttttt ataaacttga tatagtacaa 540

ctagatggca actctagtca gtatagatta ataaattgta atacctcagt cataacacaa 600

gcctgtccaa aggtctcttt tgacccaatt cctatacatt attgtgctcc agctggttat 660

gcgattctaa agtgtaataa taagacattc aatggaacag gaccgtgtaa taatgtcagc 720

acagtacaat gtacacatgg aattaagcca gtggtttcaa ctcaactatt gttaaatggt 780

agcctagcag aaggagagat aataattaga tctgaaaaca taacagacaa tggcaaaaca 840

ataatagtac atctcaatga atctgtaaag attgagtgta cgagacccag taataacaca 900

agaacaagta taagaatagg accaggacaa gcattttatg caacaggaca agtaatagga 960

gacataagag aagcacattg taacattagt gaaagtaaat ggaatgaaac tttacaaagg 1020

gtaagtgaaa aattaaaaga atacttccct cataagaata taacatttca accatcctca 1080

ggaggggacc tagaaattac aacacatagc tttaattgtg gaggagaatt tttctattgc 1140

aatacatcaa gcctgtttaa taggacatat atggctacta gtacagatat ggctaatagt 1200

acagaaacta acagtacacg aatcatcaca atccgctgca gaataaaaca aattataaac 1260

atgtggcagg aggtgggacg agcaatgtat gcccctccca ttgcaggaaa cataacatgt 1320

atatcaaata tcacaggact actattgaca agggatggag gaaaaaacaa tacggagaca 1380

ttcgagacat tcagacctgg aggaggaaat atgaaggaca attggagaag tgaattatat 1440

aaatataaag tggtagaagt taagccatta ggagtagcac ccactaatgc aaggaggaga 1500

gtggtggaga gagaaaaaag agcagtggga atgggagctg tgttccttgg gttcttggga 1560

gcggcaggaa gcactatggg cgcagcatca ataacgctga cggtacaggc cagacaatta 1620

ttgtctggta tagtgcaaca gcaaagcaat ttgctgaagg ctatagaggc tcaacagcat 1680

atgttgaaac tcacggtctg gggcattaaa cagctccagg caagagtcct ggccttggaa 1740

agatacctaa aggatcaaca gctcctaggg atgtggggct gctctggaaa actcatctgc 1800

accactaatg tatattggaa ctctagttgg agtaataaaa cttatggtga tatttgggat 1860

aacatgacct ggatgcagtg ggagagagaa attagcaatt atacagaaat aatatatgaa 1920

ctgcttgaag aatcacaaaa ccagcaggaa aagaatgaac aagatttact agcattggac 1980

agatggaaca gtctgtggaa ttggtttaac ataacaaatt ggctgtggta tataaaaata 2040

ttcataatga tagtaggagg cttgataggt ttaagaataa tttttgctgt gctttcttta 2100

gtaaatagag ttaggcaggg atactcacct ctgtcgttac agacccttat cccaagcccg 2160

aggggaccag acaggcccgg aggaatcgaa gaagaaggtg gagagcaaga cagaaacaga 2220

tcaacgcgat tagtgagcgg attcttagcg cttgcctggg acgacctgcg gagcctgtgc 2280

cttttcatct accaccgatt gagagacttc atattaattg cagcgagagc gggggaactt 2340

ctgggacgca gcagtctcaa gggactacgg agagggtggg aagcccttaa gtatctggga 2400

agtcttgtgc agtattgggg cctggaacta aaaaggagtg ctattagtct attggatacc 2460

ctagcaatag cagtaggtga aggaacagat aggattctag aatttgtatt aggaatttgt 2520

agagctatcc gcaacatacc tacaagaata agacagggct ttgaaacagc tttgctataa 2580

<210> SEQ ID NO 58

<211> LENGTH: 2589

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 58

atgagagtga tggggagaca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct actgccagca atgctactgc cagcaatagc 420

agtataatag agggaatgaa tagtagtata atagagggaa tgaaaaattg ctctttcaat 480

ataaccacag aattaagaga taagagagag aaaaagaatg cactttttta taaacttgat 540

atagtacaac tagatggcaa ctctagtcag tatagattaa taaattgtaa tacctcagtc 600

ataacacaag cctgtccaaa ggtctctttt gacccaattc ctatacatta ttgtgctcca 660

gctggttatg cgattctaaa gtgtaataat aagacattca atggaacagg accgtgtaat 720

aatgtcagca cagtacaatg tacacatgga attaagccag tggtttcaac tcaactattg 780

ttaaatggta gcctagcaga aggagagata ataattagat ctgaaaacat aacagacaat 840

ggcaaaacaa taatagtaca tctcaatgaa tctgtaaaga ttgagtgtac gagacccagt 900

aataacacaa gaacaagtat aagaatagga ccaggacaag cattttatgc aacaggacaa 960

gtaataggag acataagaga agcacattgt aacattagtg aaagtaaatg gaatgaaact 1020

ttacaaaggg taagtgaaaa attaaaagaa tacttccctc ataagaatat aacatttcaa 1080

ccatcctcag gaggggacct agaaattaca acacatagct ttaattgtgg aggagaattt 1140

ttctattgca atacatcaag cctgtttaac aggacatata tggctactag tacagatatg 1200

gctaatagta cagaaactaa cagtacacga atcatcacaa tccgctgcag aataaaacaa 1260

attataaaca tgtggcagga ggtgggacga gcaatgtatg cccctcccat tgcaggaaac 1320

ataacatgta tatcaaatat cacaggacta ctattgacaa gggatggagg aaaaaacaat 1380

acggagacat tcgagacatt cagacctgga ggaggaaata tgaaggacaa ttggagaagt 1440

gaattatata aatataaagt ggtagaagtt aagccattag gagtagcacc cactaatgca 1500

agaaggagag tggtggagag agaaaaaaga gcagtgggaa tgggagctgt gttccttggg 1560

ttcttgggag cggcaggaag cactatgggc gcagcatcaa taacgctgac ggtacaggcc 1620

agacaattat tgtctggtat agtgcaacag caaagcaatt tgctgaaggc tatagaggct 1680

caacagcata tgttgaaact cacggtctgg ggcattaaac agctccaggc aagagtcctg 1740

gccttggaaa gatacctaaa ggatcaacag ctcctaggga tgtggggctg ctctggaaaa 1800

ctcatctgca ccactaatgt atattggaac tctagttgga gtaataaaac ttatggtgat 1860

atttgggata acatgacctg gatgcagtgg gagagagaaa ttagcgatta tacagaaata 1920

atatatgaat tgcttgaaga atcacaaaac cagcaggaaa agaatgaaca agatttacta 1980

gcattggaca gatggaacag tctgtggaat tggtttaaca taacaaattg gctgtggtat 2040

ataaaaatat tcataatgat agtaggaggc ttgataggtt taagaataat ttttgctgtg 2100

ctttctttag taaatagagt taggcaggga tactcacctc tgtcgttaca gacccttatc 2160

ccaagcccga ggggaccaga caggcccgga ggaatcgaag aagaaggtgg agagcaagac 2220

agaaacagat caacgcgatt agtgagcgga ttcttagcgc ttgcctggga cgacctgcgg 2280

agcctgtgcc ttttcatcta ccaccgattg agagacttca tattaattgc agcgagagcg 2340

ggggaacttc tgggacgcag cagtctcaag ggactacgga gaggatggga agcccttaag 2400

tatctgggaa gtcttgtgca gtattggggc ctggaactaa aaaggagtgc tattagtcta 2460

ttggataccc tagcaatagc agtaggtgaa ggaacagata ggattctaga atttgtatta 2520

ggaatttgta gagctatccg caacatacct acaagaataa gacagggctt tgaaacagct 2580

ttgctataa 2589

<210> SEQ ID NO 59

<211> LENGTH: 2580

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 59

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggc ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct actgccagca atgctactgc cagcaatgct 420

actgccagca atagcagtat caatagcagt ataatagagg aaatgaaaaa ttgctctttc 480

aatataacca cagaattaag agataagaga gagaaaaaga atgcactttt ttataaactt 540

gatatagtac aactagatgg caactctagt cagtatagat taataaattg taatacctca 600

gccataacac aagcctgtcc aaaggtatct tttgacccaa ttcctataca ttattgtgct 660

ccagctggtt atgcgattct aaagtgtaat aataagacat tcaatggaac aggaccgtgt 720

aataatgtca gcacagtaca atgtacacat ggaattaagc cagtggtttc aactcaacta 780

ttgttaaatg gtagcctagc agaaggagag ataataatta gatctgaaaa tataacagac 840

aatggcaaaa caataatagt acatctcaat gaatctgtaa agattgagtg tacgagaccc 900

agtaataaca caagaacaag tataagaata ggaccaggac aagcatttta tgcaacagga 960

caagtaatag gagacataag agaagcacat tgtaacatta gtgaaagtaa atggaatgaa 1020

actttacaaa gggtaagtaa aaaattaaaa gaatacttcc ctcataagaa tataacattt 1080

caaccatcct caggagggga cctagaagtt acaacacata gctttaattg tggaggagaa 1140

tttttctatt gcaatacatc aagcctgttt aataggacag atatggctaa tagtacagaa 1200

actaacagta cacgaatcat cacaatccgc tgcagaataa aacaaattgt aaacatgtgg 1260

caggaggtgg gacgagcaat gtatgcccct cccattgcag gaaacataac atgtatatca 1320

aatatcacag gactactatt gacaagggat ggaggagaaa acaatggagg aaaaaacaat 1380

acagagacat tcagacctgg aggaggaaat atgaaggaca attggagaag tgaattatat 1440

aaatataaag tggtagaagt taagccatta ggagtagcac ccactaatgc aagaaggaga 1500

gtggtggaga gagaaaaaag agcagtggga atgggagctg tgttccttgg gttcttggga 1560

gcggcaggaa gcactatggg cgcagcatca ataacgctga cggtacaggc cagacaatta 1620

ttgtctggta tagtgcaaca gcaaagcaat ttgctgaagg ctatagaggc tcaacagcat 1680

atgttgaaac tcacggtctg gggcattaaa cagctccagg caagagtcct ggccttggaa 1740

agatacctaa aggatcaaca gctcctaggg atgtggggct gctctggaaa actcatctgt 1800

accactaatg tatattggaa ctctagttgg agtaataaaa cttatggtga tatttgggat 1860

aacatgacct ggatgcagtg ggagagagaa attagcaatt atacagaaat aatatatgaa 1920

ttgcttgaag aatcacaaaa ccagcaggaa aagaatgaac aagatttact agcattggac 1980

agatggaaca gtctgtggaa ttggtttaac ataacaaaat ggctgtggta tataaaaata 2040

ttcataatga tagtaggagg cttgataggt ttaagaataa tttttgctgt gctctcttta 2100

gtaaatagag ttaggcaggg atactcacct ctgtcattgc agacccttat cccaagcccg 2160

aggggaccag acaggcccgg aggaatcgaa gaagaaggtg gagagcaaga cagaaacaga 2220

tcaacgcgat tagtgagcgg attcttagcg cttgcctggg acgacctgcg gagcctgtgc 2280

cttttcatct accaccgatt gagagacttc atattaattg cagcgagagc gggggaactt 2340

ctgggacgca gcagtctcaa gggactacgg agaggatggg aagcccttaa gtatctggga 2400

ggtcttgtgc agtattgggg cctggaacta aaaaggagtg ctattagtct attggatacc 2460

ctagcaatag cagtaggtga aggaacagat aggattctag aatttgtatt aggaatttgt 2520

agagctatcc gcaacatacc tacaagaata agacagggct ttgaaacagc tttgctataa 2580

<210> SEQ ID NO 60

<211> LENGTH: 2598

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 60

atgagagtga tggggagaca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcacgc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct actgccagca atgctactgc cagcaatgct 420

actgccagca atgctactgc cagcaatagc agtataataa tagagggaat gaaaaattgc 480

tctttcaata taaccacaga attaagagat aagagagaga aaaagaatgc acttttttat 540

aaacttgata tagtacaact agatggcaac tctagtcagt atagattaat aaattgtaat 600

acctcagtca taacacaagc ctgtccaaag gtctcttttg acccaattcc tatacattat 660

tgtgctccag ctggttatgc gattctaaag tgtaataata agacattcaa tggaacagga 720

ccgtgtaata atgtcagcac agtacaatgt acacatggaa ttaagccagt ggtttcaact 780

caactattgt taaatggtag cctagcagaa ggagagataa taattagatc taaaaatata 840

acagacaatg gcaaaacaat aatagtacat ctcaatgaat ctgtaaagat tgagtgtacg 900

agacccagta ataacacaag aacaagtata agaataggac caggacaagc attttatgca 960

acaggacaag taataggaga cataagagaa gcacattgta acattagtga aagtaaatgg 1020

aatgaaactt tacaaagggt aagtgaaaaa ttaaaagaat acttccctaa taagaatata 1080

acatttcaac catcctcagg aggggaccta gaaattacaa cacatagctt taattgtgga 1140

ggagaatttt tctattgcaa tacatcaagc ctgtttaata ggacatatat ggctaatagt 1200

acagatatgg ctaatagtac agaaactaac agtacacgaa tcatcacaat ccgctgcaga 1260

ataaaacaaa ttataaacat gtggcaggag gtgggacgag caatgtatgc ccctcccatt 1320

gcaggaaaca taacatgtat atcaaatatc acaggactac tattgacaag ggatggagga 1380

aaaaacaata cggagacatt cgagacattc agacctggag gaggaaatat gaaggacaat 1440

tggagaagtg aattatataa atataaagtg gtagaagtta agccattagg agtagcaccc 1500

actaatgcaa gaaggagagt ggtggagaga gaaaaaagag cagtgggaat gggagctgtg 1560

ttccttgggt tcttgggagc ggcaggaagc actatgggcg cagcatcaat aacgctgacg 1620

gtacaggcca gacaattatt gtctggtata gtgcaacagc aaagcaattt gctgaaggct 1680

atagaggctc aacagcatat gttgaaactc acggtctggg gcattaaaca gctccaggca 1740

agagtcctgg ccttggaaag atacctaaag gatcaacagc tcctagggat gtggggctgc 1800

tctggaaaac tcatctgcac cactaatgta tattggaact ctagttggag taataaaact 1860

tatggtgata tttgggataa catgacctgg atgcagtggg agagagaaat tagcaattat 1920

acagaaatga tatatgaatt gcttgaagaa tcacaaaacc agcaggaaaa gaatgaacaa 1980

gatttactag cattggacag atggaacagt ctgtggaatt ggtttaacat aacaaagtgg 2040

ctgtggtata taaaaatatt cataatgata gtaggaggct tgataggttt aagaataatt 2100

tttgctgtgc tttctttagt aaatagagtt aggcagggat actcacctct gtcgttgcag 2160

acccttatcc caagcccgag gggaccagac aggcccggag gaatcgaaga agaaggtgga 2220

gagcaagaca gaaagagatc aacgcgatta gtgagcggat tcttagcgct tgcctgggac 2280

gacctgcgga gcctgtgcct tttcatctac caccgattga gagacttcat attaattgca 2340

gcgagagcgg gggaacttct gggacgcagc agtctcaagg gactacggag aggatgggaa 2400

gcccttaagt atctgggaag tcttgtgcag tattggggcc gggaactaaa aaggagtgct 2460

attagtctat tggataccct agcaatagca gtaggtgaag gaacagatag gattctagaa 2520

tttgcattaa gaatttgtag agctatccgc aacatgccta caagaataag acagggcttt 2580

gaaacagctt tgctataa 2598

<210> SEQ ID NO 61

<211> LENGTH: 2592

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 61

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt agatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct actgccagca atgctactgc cagcaatgct 420

actgccagca atgctactgc cagcaatagc agtataataa tagagggaat gaaaaattgc 480

tctttcaata taaccacaga attaagagat aagagagaga aaaagaatgc acttttttat 540

aaacttgata tagtacaact agatggcaac tctagtcagt atagattaat aaattgtaat 600

acctcagtca taacacaagc ctgtccaaag gtctcttttg acccaattcc tatacattat 660

tgtgctccag ctggttatgc gattctaaag tgtaataata agacattcaa tggaacagga 720

ccgtgtaata atgtcagcac agtacaatgt acacatggaa ttaagccagt ggtttcaact 780

caactattgt taaatggtag cctagcagaa ggagagataa taattagatc taaaaatata 840

acagacaatg gcaaaacaat aatagtacat ctcaatgaat ctgtaaagat tgagtgtacg 900

agacccagta ataacacaag aacaagtata agaataggac caggacaagc attttatgca 960

acaggacaag taataggaga cataagagaa gcacattgta acattagtga aagtaaatgg 1020

aatgaaactt tacaaagggt aagtaaaaaa ttaaaagaat acttccctca gaagaatata 1080

acatttcaac catcctcagg aggggaccta gaaattacaa cacatagctt taattgtgga 1140

ggagaatttt tctattgcaa tacatcaagc ctgtttaata ggacatatat ggctaatagt 1200

acagatatgg ctaatagtac agaaactaac agaaccatca caatccgctg cagaataaaa 1260

caaattataa acatgtggca ggaggtggga cgagcaatgt atgcccctcc cattgcagga 1320

aacataacat gtatatcaaa tatcacagga ctactattga caagggatgg aggaaaaaac 1380

aatacggaga cattcgagac attcagacct ggaggaggaa atatgaagga caattggaga 1440

agtgaattat ataaatataa agtggtagaa gttaagccat taggagtagc acccactaat 1500

gcaagaagga gagtggtgga gagagaaaaa agagcagtgg gaatgggagc tgtgttcctt 1560

gggttcttgg gagcggcagg aagcactatg ggcgcagcat caataacgct gacggtacag 1620

gccagacaat tattgtctgg tatagtgcaa cagcaaagca atttgctgaa ggctatagag 1680

gctcaacagc atatgttgaa actcacggtc tggggcatta aacagctcca ggcaagagtc 1740

ctggccttgg aaagatacct aaaggatcaa cagctcctag ggatgtgggg ctgctctgga 1800

aaactcatct gcaccactaa tgtatattgg aactctagtt ggagtaataa aacttatggt 1860

gatatttggg ataacatgac ctggatgcag tgggagagag aaattagcaa ttatacagaa 1920

atgatatatg aattgcttga agaatcacaa aaccagcagg aaaagaatga acaagattta 1980

ctagcattgg acagatggaa cagtctgtgg aattggttta acataacaaa gtggctgtgg 2040

tatataaaaa tattcataat gatagtagga ggcttgatat gtttaagaat aatttttgct 2100

gtgctttctt tagtaaatag agttaggcag ggatactcac ctctgtcgtt gcagaccctt 2160

atcccaagcc cgaggggacc agacaggccc ggaggaatcg aagaagaagg tggagagcaa 2220

gacagaaaga gatcaacgcg attagtgagc ggattcttag cgcttgtctg ggacgacctg 2280

cggagcctgt gccttttcat ctaccaccga ttgagagact tcatattaat tgcagcgaga 2340

gcgggggaac ttctgggacg cagcagtctc aagggactac ggagaggatg ggaagccctt 2400

aagtatctgg gaagtcttgt gcagtattgg ggcctggaac taaaaaggag tgctattagt 2460

ctattggata ccctagcaat agcagtaggt gaaggaacag ataggattct agaatttgca 2520

ttaggaattt gtagagctat ccgcaacata cctacaagaa taagacaggg ctttgaaaca 2580

gctttgctat aa 2592

<210> SEQ ID NO 62

<211> LENGTH: 2547

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 62

atgagagtga cggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggc agatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcgatgcc aatgctactg ccagcaatgc tactgccagc 420

aatagcagta taatagaggg aatgaaaaat tgctctttca atataaccac agaattaaga 480

gataagatag agaaaaagaa tgcacttttt tataaacttg atatagtaca actagatggc 540

aactctagtc agtatagatt aataaattgt aatacctcag tcataacaca agcctgtcca 600

aaggtctctt ttgacccaat tcctatacat tattgtgctc cagctggtta tgcgattcta 660

aagtgtaata ataagacatt caatggaaca ggaccgtgta ataatgtcag cacagtacaa 720

tgtacacatg gaattaagcc agtggtttca actcaactat tgttaaatgg tagcctagca 780

gaaggagaga taataattag atctgaaaat ataacaaaca gtgccaaaac aataatagta 840

catctcaatg aatctgtaaa gattgagtgt acgagaccca gtaataacac aagaacaagt 900

ataagaatag gaccaggaca agcattttat gcaacaggac aagtaatagg agacataaga 960

aaagcacatt gtaacattag tgaaagtaaa tggaatgaaa ctttacaaag ggtaagtaaa 1020

aaattaaaag aatacttccc tcataagaat ataacatttc aaccatcctc aggaggggac 1080

ctagaaatta caacacatag ctttaattgt ggaggagaat ttttctattg caatacatca 1140

agcctgttta ataggacata catggctaat agtacagaaa ctaacagtac acgaaccatc 1200

acactccact gcagaataaa acaaattata aacatgtggc aggaggtggg acgagcaatg 1260

tatgcccctc ccattgcagg aaacataaca tgtatatcaa atatcacagg actactattg 1320

acaagggatg gaggaaataa caatactacg gagacattca gacctggagg aggaaatatg 1380

aaggacaatt ggagaagtga attatataaa tataaagtgg tagaaattaa gccattagga 1440

gtagcaccca ctaatgcaag aaggagagtg gtggagagag aaaaaagagc agtgggaatg 1500

ggagctgtgt tccttgggtt cttgggagcg gcaggaagca ctatgggcgc agcatcaata 1560

acgctgacgg tacaggccag acaattattg tctggtatag tgcaacagca aagcaatttg 1620

ctgaaggcta tagaggctca acagcatatg ttgaaactca cggtctgggg cattaaacag 1680

ctccaggcaa gagtcctggc cttggaaaga tacctaaagg atcaacagct cctagggatg 1740

tggggctgct ctggaaaact catctgcacc actaatgtat attggaactc tagttggagt 1800

aataaaactt atggtgatat ttgggataac atgacctgga tgcagtggga gagagaaatt 1860

agcgattata cagaaataat atatgaattg cttgaagaat cacaaaacca gcaggaaaag 1920

aatgaacaag atttactagc attggacaga tggaacagtc tgtggaattg gtttaacata 1980

acaaactggc tgtggtatat aaaaatattc ataatgatag taggaggctt gataggttta 2040

agaataattt ttgctgtgct ttctttagta aatagagtta ggcagggata ctcacctctg 2100

tcgttgcaga cccttacccc aagcccgagg ggaccagaca ggcccggagg aatcgaagaa 2160

gaaggtggag agcaagacag aaacagatca acgcgattag tgagcggatt cttagcgctt 2220

gcctgggacg acctgcggag cctgtgcctt ttcatctacc accgattgag agacttcata 2280

ttaattgcag cgagagcggg ggaacttctg ggacgcagca gtctcaaggg actacggaga 2340

ggatgggaag cccttaagta tctgggaggt cttgtgcagt attggggcct ggaactaaaa 2400

aggagtgcta ttagtctatt ggatacccta gcaatagcag taggtgaagg aacagatagg 2460

attctagaat ttgtattagg aatttgtaga gctatccgca acatacctac aagaataaga 2520

cagggctttg aaacagcttt gctataa 2547

<210> SEQ ID NO 63

<211> LENGTH: 2559

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 63

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaattttaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttaacccca 360

ctctgtgtca ctctagactg tatcaatgct actaatgcta ctgccagcaa tagcagtata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tactcatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat ggcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggag acataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtaaaaa attaaaagaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggttaatag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

accatcacaa tccgctgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg agaaaacaat acggagacat tcgagacatt cagacctgga 1380

ggaggaaata tgaaggacaa ttggagaagt gaattatata aatataaagt ggtagaagtt 1440

aagccattag gagtagcacc cactaatgca agaaggagag tggtggagag agaaaaaaga 1500

gcagtgggaa tgggagctgt gttccttggg ttcttgggag cggcaggaag cactatgggc 1560

gcagcatcaa taacgctgac ggtacaggcc agacaattat tgtctggtat agtgcaacag 1620

caaagcaatt tgctgaaggc tatagaggct caacagcata tgttgaaact cacggtctgg 1680

ggcattaaac agctccaggc aagagtcctg gccttggaaa gatacctaaa ggatcaacag 1740

ctcctaggga tgtggggctg ctctggaaaa ctcatctgca ccactaatgt atattggaac 1800

tctagttgga gtaataaaac ttatggtgat atttgggata acatgacctg gatgcagtgg 1860

gagagagaaa ttagcaatta tacagaacta atatatgaat tgcttgaaga atcacaaaac 1920

cagcaggaaa agaatgaaca agatttacta gcattggaca gatggaacag tctgtggaat 1980

tggtttaaca taacaaattg gctgtggtat ataaaaatat tcataatgat agtaggaggc 2040

ttgataggtt taagaataat ttttgctgtg ctttctttag taaatagagt taggcaggga 2100

tactcacctc tgtcattgca gacccttatc ccaagcccga ggggaccaga caggcccgga 2160

ggaatcgaag aagaaggtgg agagcaagac agaaacagat caacgcgatt agtgagcgga 2220

ttcttagcgc ttgcctggga cgacctgcgg agcctgtgcc ttttcatcta ccaccgattg 2280

agagacttca tattaattgc agcgagagcg ggggaacttc tgggacgcag cagtctcaag 2340

ggactacgga gagggtggga agcccttaag tatctgggaa gtcttgtgca gtattggggc 2400

ctggaactaa aaaggagtgc tattagtcta ttggataccc tagcaatagc agtaggtgaa 2460

ggaacagata ggattctaga atttgtatta ggaatttgta gagctatccg caacatacct 2520

acaagaataa gacagggctt tgaaacagct ttgctataa 2559

<210> SEQ ID NO 64

<211> LENGTH: 2559

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 64

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaag gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgccagcaa taacagtata 420

ttagagggaa tgaaaaattg ctctttcaat atagccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac tagatggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat ggcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtaaaaa attaaaagaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttagttgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctactaa tacagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacaa tccgctgcag aataagacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg agaaaacaat acggagacat tcgagacatt cagacctgga 1380

ggaggaaata tgaaggacaa ttggagaagt gaattatata aatataaagt ggtagaagtt 1440

aagccattag gagtagcacc cactaatgca agaaggagag tggtggagag agaaaaaaga 1500

gcagtgggaa tgggagctgt gttccttggg ttcttgggag cggcaggaag cactatgggc 1560

gcagcatcaa taacgctgac ggtacaggcc agacaattat tgtctggtat agtgcaacag 1620

caaagcaatt tgctgaaggc tatagaggct caacagcata tgttgaaact cacggtctgg 1680

ggcattaaac agctccaggc aagagtcctg gccttggaaa gatacctaaa ggatcaacag 1740

ctcctaggga tgtggggctg ctctggaaaa ctcatctgca ccactaatgt atattggaac 1800

tctagttgga gtaataaaac ttatggtgat atttgggata acatgacctg gatgcagtgg 1860

gagagagaaa ttagcaatta tacagaacta atatatgaat tgcttgaaga atcacaaaac 1920

cagcaggaaa agaatgaaca agatttacta gcattggaca gatggaacag tctgtggaat 1980

tggtttaaca taacaaattg gctgtggtat ataaaaatat tcataatgat agtaggaggc 2040

ttgataggtt taagaataat ttttgctgtg ctttctttag taaatagagt taggcaggga 2100

tactcacctc tgtcattgca gacccttatc ccaagcccga ggggaccaga caggcccgga 2160

ggaatcgaag aagaaggtgg agagcaagac agaaacagat caacgcgatt agtgagcgga 2220

ttcttagcgc ttgcctggga cgacctgcgg agcctgtgcc ttttcatcta ccaccgattg 2280

agagacttca tattaattgc agcgagagcg ggggaacttc tgggacgcag cagtctcaag 2340

ggactacgga gagggtggga agcccttaag tatctgggaa gtcttgtgca gtattggggc 2400

ctggaactaa aaaggagtgc tattagtcta ttggataccc tagcaatagc agtaggtgaa 2460

ggaacagata ggattctaga atttgtatta ggaatttgta gagctatccg caacatacct 2520

acaagaataa gacagggctt tgaaacagct ttgctataa 2559

<210> SEQ ID NO 65

<211> LENGTH: 2550

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 65

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaagctg taccaatgct actaatgcta ctgccagcaa tagcagtata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac tagatggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat ggcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggag acataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctc ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctactag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacaa tccgctgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaaaaacgat acggatacat tcagacctga aggaggaaat 1380

atgaaggaca attggagaag tgaattatat aaatataaag tggtagaagt taagccatta 1440

ggagtagcac ccactaatgc aagaaggaga gtggtggaga gagaaaaaag agcagtggga 1500

atgggagctg tgttccttgg gttcttggga gcggcaggaa gcactatggg cgcagcatca 1560

ataacgctga cggtacaggc cagacaatta ttgtctggta tagtgcaaca gcaaagcaat 1620

ttgctgaagg ctatagaggc tcaacagcat atgttgaaac tcacggtctg gggcattaaa 1680

cagctccagg caagagtcct ggccttggaa agatacctaa aggatcaaca gctcctaggg 1740

atgtggggct gctctggaaa actcatctgc accactaatg tatattggaa ctctagttgg 1800

agtaataaaa cttatggtga tatttgggat aacatgacct ggatgcagtg ggagagagaa 1860

attagcaatt atacagaact aatatatgaa ttgcttgaag aatcacaaaa ccagcaggaa 1920

aagaatgaac aagatttact agcattggac agatggaaca gtctgtggaa ttggtttaac 1980

ataacaaatt ggctgtggta tataaaaata ttcataatga tagtaggagg cttgataggt 2040

ttaagaataa tttttgctgt gctttcttta gtaaatagag ttaggcaggg atactcacct 2100

ctgtcattgc agacccttat cccaagcccg aggggaccag acaggcccgg aggaatcgaa 2160

gaagaaggtg gagagcaaga cagaaacaga tcaacgcgat tagtgagcgg attcttagcg 2220

cttgcctggg acgacctgcg gagcctgtgc cttttcatct accaccgatt gagagacttc 2280

atattaattg cagcgagagc gggggaactt ctgggacgca gcagtctcaa gggactacgg 2340

agagggtggg aagcccttaa gtatctggga aatcttgtgc agtattgggg cctggaacta 2400

aaaaggagtg ctattagtct attggatacc ctagcaatag cagtaggtga aggaacagat 2460

aggattctag aatttgtatt aggaatttgt agagctatcc gcaacatacc tacaagaata 2520

agacagggct ttgaaacagc tttgctataa 2550

<210> SEQ ID NO 66

<211> LENGTH: 2562

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 66

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcgatgct actgccagca atgctactgc catcaatatc 420

agtataatag aggaaatgaa aaattgctct ttcaatataa ccacagaatt aagagataag 480

agagagaaaa agaatgcact tttttataaa cttgatatag tacaactaga tggcaactct 540

agtcagcata gattaataaa ttgtaatacc tcagtcataa cacaagcctg tccaaaggtc 600

tcttttgacc caattcctat acattattgt gctccagctg gttatgcgat tctaaagtgt 660

aataataaga cattcaatgg aacaggaccg tgtaataatg tcagcacagt acaatgtaca 720

catggaatta agccagtggt ttcaactcaa ctattgttaa atggtagcct agcagaagga 780

gagataataa ttagatctaa aaatataaca gacaatggca aaacaataat agtacatctc 840

aatgaatctg taaagattga gtgtacgaga cccagtaata acacaagaac aagtataaga 900

ataggaccag gacaagcatt ttatgcaaca ggacaagtaa taggaaatat aagagaagca 960

cattgtaaca ttagtgaaag taaatggaat gaaactttac aaagggtaag tgaaaaatta 1020

aaagaatact tccctcataa gaatataaca tttcaaccat cctcaggagg ggacctagaa 1080

attacaacac atagctttaa ttgtggagga gaatttttct attgcaatac atcaagcctg 1140

tttaatagga catatatggc tactagtaca gatatggcta atagtacaga aactaacagt 1200

acacgaatca tcacaatccg ctgcagaata aaacaaatta taaacatgtg gcaggaggtg 1260

ggacgagcaa tgtatgcccc tcccattgca ggaaacataa catgtatatc aaatatcaca 1320

ggactactat tgacaaggga tggaggaaaa aacgatacgg atacggagac attcagacct 1380

gaaggaggaa atatgaagga caattggaga agtgaattat ataaatataa agtggtagaa 1440

gttaagccat taggagtagc acccactaat gcaagaagga gagtggtgga gagagaaaaa 1500

agagcagtgg gaatgggagc tgtgttcctt gggttcttgg gagcggcagg aagcactatg 1560

ggcgcagcat caataacgct gacggtacag gccagacaat tattgtctgg tatagtgcaa 1620

cagcaaagca atttgctgaa ggctatagag gctcaacagc atatgttgaa actcacggtc 1680

tggggcatta aacagctcca ggcaagagtc ctggccttgg aaagatacct aaaggatcaa 1740

cagctcctag ggatgtgggg ctgctctgga aaactcatct gcaccactaa tgtatattgg 1800

aactctagtt ggagtaataa aacttatggt gatatttggg ataacatgac ctggatgcag 1860

tgggagagag aaattagcaa ttatacagac ataatatatg aattgcttga agaatcacaa 1920

aaccagcagg aaaagaatga acaagattta ctagcattgg acagatggaa cagtctgtgg 1980

aattggttta acataacaaa ttggctgtgg tatataaaaa tattcataat gatagtagga 2040

ggcttgatag gtttaagaat aatttttgct gtgctttctt tagtaaatag agttaggcag 2100

ggatactcac ctctgtcatt gcagaccctt atcccaagcc cgaggggacc agacaggccc 2160

ggaggaatcg aagaagaagg tggagagcaa gacagaaaca gatcaacgcg attagtgagc 2220

ggattcttag cgcttgtctg ggacgacctg cggagcctgt gccttttcat ctaccaccga 2280

ttgagagact tcatattaat tgcagcgaga gcgggggaac ttctgggacg cagcagtctc 2340

aagggactac ggagagggtg ggaagccctt aagtatctgg gaagtcttgt gcagtattgg 2400

ggcctggaac taaaaaggag tgctattagt ctattggata ccctagcaat agcagtaggt 2460

gaaggaacag ataggattct agaatttgta ttaggaattt gtagagctat ccgcaacata 2520

cctacaagaa taagacaggg ctttgaaaca gctttgctat aa 2562

<210> SEQ ID NO 67

<211> LENGTH: 2562

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 67

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcgatgct actgccagca atgctactgc catcaatatc 420

agtataatag aggaaatgaa aaattgctct ttcaatataa ccacagaatt aagagataag 480

agagagaaaa agaatgcact tttttataaa cttgatatag tacaactaga tggcaactct 540

agtcagcata gattaataaa ttgtaatacc tcagtcataa cacaagcctg tccaaaggtc 600

tcttttgacc caattcctat acattattgt gctccagctg gttatgcgat tctaaagtgt 660

aataataaga cattcaatgg aacaggaccg tgtaataatg tcagcacagt acaatgtaca 720

catggaatta agccagtggt ttcaactcaa ctattgttaa atggtagcct agcagaagga 780

gagataataa ttagatctaa aaatataaca gacaatggca aaacaataat agtacatctc 840

aatgaatctg taaagattga gtgtacgaga cccagtaata acacaagaac aagtataaga 900

ataggaccag gacaagcatt ttatgcaaca ggacaagtaa taggaaatat aagagaagca 960

cattgtaaca ttagtaaaag taaatggaat gaaactttac aaagggtaag tgaaaaatta 1020

aaagaatact tccctcataa gaatataaca tttcaaccat cctcaggagg ggacctagaa 1080

attacaacac atagctttaa ttgtggagga gaatttttct attgcaatac atcaagcctg 1140

tttaatagga catatatggc tactagtaca gatatggcta atagtacaga aactaacagt 1200

acacgaatca tcacaatccg ctgcagaata aaacaaatta taaacatgtg gcaggaggtg 1260

ggacgagcaa tgtatgcccc tcccattgca ggaaacataa catgtatatc aaatatcaca 1320

ggactactat tgacaaggga tggaggaaaa aacgatacgg atacggagac attcagacct 1380

gaaggaggaa atatgaagga caattggaga agtgaattat ataaatataa agtggtagaa 1440

gttaagccat taggagtagc acccactaat gcaagaagga gagtggtgga gagagaaaaa 1500

agagcagtgg gaatgggagc tgtgttcctt gggttcttgg gagcggcagg aagcactatg 1560

ggcgcagcat caataacgct gacggtacag gccagacaat tattgtctgg tatagtgcaa 1620

cagcaaagca atttgctgaa ggctatagag gctcaacagc atatgttgaa actcacggtc 1680

tggggcatta aacagctcca ggcaagagtc ctggccttgg aaagatacct aaaggatcaa 1740

cagctcctag ggatgtgggg ctgctctgga aaactcatct gcaccactaa tgtatattgg 1800

aactctagtt ggagtaataa aacttatggt gatatttggg ataacatgac ctggatgcag 1860

tgggagagag aaattagcaa ttatacagac ataatatatg aattgcttga agaatcacaa 1920

aaccagcagg aaaagaatga acaagattta ctagcattgg acagatggaa cagtctgtgg 1980

aattggttta acataacaaa ttggctgtgg tatataaaaa tattcataat gatagtagga 2040

ggcttgatag gtttaagaat aatttttgct gtgctttctt tagtaaatag agttaggcag 2100

ggatactcac ctctgtcatt gcagaccctt atcccaagcc cgaggggacc agacaggccc 2160

ggaggaatcg aaaaagaagg tggagagcaa gacagaaaca gatcaacgcg attagtgagc 2220

ggattcttag cgcttgtctg ggacgacctg cggagcctgt gccttttcat ctaccaccga 2280

ttgagagact tcatattaat tgcagcgaga gcgggggaac ttctgggacg cagcagtctc 2340

aagggactac ggagagggtg ggaagccctt aagtatctgg gaagtcttgt gcagtattgg 2400

ggcctggaac taaaaaggag tgctattagt ctattggata ccctagcaat agcagtaggt 2460

gaaggaacag ataggattct agaatttgta ttaggaattt gtagagctat ccgcaacata 2520

cctacaagaa taagacaggg ctttgaaaca gctttgctat aa 2562

<210> SEQ ID NO 68

<211> LENGTH: 2580

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 68

atgagagtga tggggataca gaggaattat acacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgtt aatgctactg ccagcaatag cagtataata 420

gagggaatga atagcagtat attagaggga atgaaaaatt gctctttcaa tataaccaca 480

gaattaagag ataagagaga gaaaaagaat gcactttttt ataaacttga tatagtacaa 540

ctaggtggca actctagtca gtatagatta ataaattgta atacctcagt cataacacaa 600

gcctgtccaa aggtctcttt tgacccaatt cctatacatt attgtgctcc agctggttat 660

gcgattctaa agtgtaataa taagacattc aatggaacag gaccgtgtaa taatgtcagc 720

acagtacaat gtacacatgg aattaagcca gtggtttcaa ctcaactatt gttaaatggt 780

agcctagcag aaggagagat aataattaga tctaaaaata taacagacaa tggcaaaaca 840

ataatagtac atctcaatga atctgtaaag attgagtgta cgagacccag taataacaca 900

agaacaagta taagaatagg accaggacaa gcattttatg caacaggaca agtaatagga 960

gacataagag aagcacattg taacattagt gaaagtaaat ggaatgaaac tttacaaagg 1020

gtaagtgaaa aattaaaaga atacttccct gataagaata taacatttca accatcctca 1080

ggaggggacc tagaaattac aacacatagc tttaattgtg gaggagaatt tttctattgc 1140

aatacatcaa gcctgtttaa taggacatat atggctaata gtacagatat ggctaatagt 1200

acagaaacta acagtacacg aatcatcaca atccgctgca gaataaaaca aattataaac 1260

atgtggcagg aggtgggacg agcaatgtat gcccctccca ttgcaggaaa cataacatgt 1320

atatcaaata tcacaggact actattgaca agggatggag gagaaaacaa tacggagaca 1380

ttcgagacat tcagacctgg aggaggaaat atgaaggaca attggagaag tgaattatat 1440

aaatataaag tggtagaagt taagccatta ggagtagcac ccactaatgc aagaaggaga 1500

gtggtggaga gagaaaaaag agcagtggga atgggagctg tgttccttgg gttcttggga 1560

gcggcaggaa gcactatggg cgcagcatca ataacgctga cggtacaggc cagacaatta 1620

ttgtctggta tagtgcaaca gcaaagcaat ttgctgaagg ctatagaggc tcaacagcat 1680

atgttgaaac tcacggtctg gggcattaaa cagctccagg caagagtcct ggccttggaa 1740

agatacctaa aggatcaaca gctcctaggg atgtggggct gctctggaaa actcatctgc 1800

accactaatg tatattggaa ctctagttgg agtaataaaa cttatggtga tatttgggat 1860

aacatgacct ggatgcagtg ggagagagaa attagcaatt atacagaact aatatatgaa 1920

ttgcttgaag aatcacaaaa ccagcaggaa aagaatgaac aagatttact agcattggac 1980

agatggaaca gtctgtggga ctggtttaac ataacaaatt ggctgtggta tataaaaata 2040

ttcataatga tagtaggagg cttgataggt ttaagaataa tttttgctgt gctttcttta 2100

gtaaatagag ttaggcaggg atactcacct ctgtcattgc agacccttat cccaagcccg 2160

aggggaccag acaggcccgg aggaatcgaa gaagaaggtg gagagcaaga cagaaacaga 2220

tcaacgcgat tagtgagcgg attcttagcg cttgcctggg acgacctgcg gagcctgtgc 2280

cttttcatct accaccgatt gagagacttc atattaattg cagcgagagc gggggaactt 2340

ctgggacgca gcagtctcaa gggactacgg agagggtggg aagcccttaa gtatctggga 2400

agtcttgtgc agtattgggg cctggaacta aaaaggagtg ctattagtct attggatacc 2460

ctagcaatag cagtaggtga aggaacagat aggattctag aatttgtatt aggaatttgt 2520

agagctatcc gcaacatacc tacaagaata agacagggct ttgaaacagc tttgctataa 2580

<210> SEQ ID NO 69

<211> LENGTH: 2553

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 69

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgccagcaa tagcagtata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac tagatggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accatgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat ggcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctc agaagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

agaacatata tggctactag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacaa tccgctgcag gataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacgatacg gatacggaga cattcagacc tgaaggagga 1380

aatatgaagg acaattggag aagtgaatta tataaatata aagtggtaga agttaagcca 1440

ttaggagtag cacccactaa tgcaagaagg agagtggtgg agagagaaaa aagagcagtg 1500

ggaatgggag ctgtgttcct tgggttcttg ggagcggcag gaagcactat gggcgcagca 1560

tcaataacgc tgacggtaca ggccagacaa ttattgtctg gtatagtgca acagcaaagc 1620

aatttgctga aggctataga ggctcaacag catatgttga aactcacggt ctggggcatt 1680

aaacagctcc aggcaagagt cctggccttg gaaagatacc taaaggatca acagctccta 1740

gggatgtggg gctgctctgg aaaactcatc tgcaccacta atgtatattg gaactctagt 1800

tggagtaata aaacttatgg tgatatttgg gataacatga cctggatgca gtgggagaga 1860

gaaattagca attatacaga cataatatat gaattgcttg aagaatcaca aaaccagcag 1920

gaaaagaatg aacaagattt actagcattg gacagatgga acagtctgtg gaattggttt 1980

aacataacaa attggctgtg gtatataaaa atattcataa tgatagtagg aggcttgata 2040

ggtttaagaa taatttttgc tgtgctttct ttagtaaata gagttaggca gggatactca 2100

cctctgtcat tgcagaccct tatcccaagc ccgaggggac cagacaggcc cggaggaatc 2160

gaagaagaag gtggagagca agacagaaac agatcaacgc gattagtgag cggattctta 2220

gcgcttgcct gggacgacct gcggagcctg tgccttttca tctaccaccg attgagagac 2280

ttcatattaa ttgcagcgag agcgggggaa cttctgggac gcagcagtct caagggacta 2340

cggagagggt gggaagccct taagtatctg ggaagtcttg tgcagtattg gggcctggaa 2400

ctaaaaagga gtgctattag tctattggat accctagcaa tagcagtagg tgaaggaaca 2460

gataggattc tagaatttgt attaggaatt tgtagagcta tccgcaacat acctacaaga 2520

ataagacagg gctttgaaac agctttgcta taa 2553

<210> SEQ ID NO 70

<211> LENGTH: 2553

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 70

atgagagtga gggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaag gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgccagcaa tagcagtata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac tagatggcaa ctctagtcaa 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat ggcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggag acataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctaatag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacac tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaat ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg gaacgatacg gatacggaga cattcagacc tgaaggagga 1380

aatatgaagg acaattggag aagtgaatta tataaatata aagtggtaga agttaagcca 1440

ttaggagtag cacccactaa tgcaagaagg agagtggtgg agagagaaaa aagagcagtg 1500

ggaatgggag ctgtgttcct tgggttcttg ggagcggcag gaagcactat gggcgcagca 1560

tcaataacgc tgacggtaca ggccagacaa ctattgtctg gtatagtgca acagcaaagc 1620

aatttgctga aggctataga ggctcaacag catatgttga aactcacggt ctggggcatt 1680

aaacagctcc aggcaagagt cctggccttg gaaagatacc taaaggatca acagctccta 1740

gggatgtggg gctgctctgg aaaactcatc tgcaccacta atgtatattg gaactctagt 1800

tggagtaata aaacttatgg tgatatttgg gataacatga cctggatgca gtgggagaga 1860

gaaattagca attatacaga cataatatat gaattgcttg aagaatcaca aaaccagcag 1920

gaaaagaatg aacaagattt actagcattg gacagatgga acagtctgtg gaattggttt 1980

aacataacaa attggctgtg gtatataaaa atattcataa tgatagtagg aggcttgata 2040

ggtttaagaa taatttttgc tgtgctttct ttagtaaata gagttaggca gggatactca 2100

cctctgtcat tgcagaccct tatcccaagc ccgaggggac cagacaggcc cggaggaatc 2160

gaagaaggag gtggagagca agacagaaac agatcaacgc gattagtgag cggattctta 2220

gcgcttgcct gggacgacct gcggagcctg tgccttttca tctaccaccg attgagagac 2280

ttcatattaa ttgcagcgag agcgggggaa cttctgggac gcagcagtct caagggacta 2340

cggagagggt gggaagccct taagtatctg ggaagtcttg tgcagtattg gggcctggaa 2400

ctaaaaagga gtgctattag tctattggat accctagcaa tagcagtagg tgaaggaaca 2460

gataggattc tagaatttgt attaggaatt tgtagagcta tccgcaacat acctacaaga 2520

ataagacagg gctttgaaac agctttgcta taa 2553

<210> SEQ ID NO 71

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 71

atgagagtga tggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaag gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgccagcaa tagcagtata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac tagatggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacgcatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat ggcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggag acataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaaa tctgtttaat 1140

aggacatata tggttaatag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

accatcacaa tcagctgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaaaaacgat acggatacgg agacattcag acctgaagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agttggagta ataaaactta tggtgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac agacataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaagga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 72

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 72

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct actaatgcta ctgccagcaa tagcagtata 420

ttagggggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac tagatggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagcc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgcgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accatgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaacat aacagacaat ggcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggag acataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctaatag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacaa tccgctgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaaaaatgat acggatacgg agacattcag acctgaagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agttggagta ataaaactta tggtgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac agaactaata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaactggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaagga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 73

<211> LENGTH: 2577

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 73

atgagagtga tggggataca gaagaattgt ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tactgatgct aatgctactg ccagcaatag cagtataata 420

aagggaatga atagcagtat gatagaggaa atgaaaaatt gctctttcaa tataaccaca 480

gaattaagag ataagagaga gaaaaagaat gcactttttt ataaacttga tatagtacaa 540

ctagatggca actctagtca gtatagatta ataaattgta atacctcagt cataacacaa 600

gcctgtccaa aggtctcttt tgacccaatt cctatacatt attgtgctcc agctggttat 660

gcgattctaa agtgtaataa taagacattc aatggaacag gaccgtgtaa taatgtcagc 720

acagtacaat gtacacatgg aattaagcca gtggtttcaa ctcaactatt gttaaatggt 780

agcctagcag aaggagagat aataattaga tctaaaaata taacagacaa tggcaaaaca 840

ataatagtac atctcaatga atctgtaaag attgagtgta cgagacccag taataacaca 900

agaacaagta taagaatagg accaggacaa gcattttatg caacaggaca agtaatagga 960

gacataagag aagcacattg taacattagt gaaagtaaat ggaatgaaac tttacaaagg 1020

gtaagtaaaa aattaaaaga atacttccct cagaaagata taacatttca accatcctca 1080

ggaggggacc tagaaattac aacacatagc tttaattgtg gaggagaatt tttctattgc 1140

aatacatcaa gcctgtttaa taggacatat atggctacta gtacagatat ggctaatagt 1200

acagaaacta acagtacacg aatcatcaca atccgctgca gaataaaaca aattataaac 1260

atgtggcagg aggtgggacg agcaatgtat gcccctccca ttgcaggaaa cataacatgt 1320

atatcaaata tcacaggact actattgaca agggatggag gagaaaacga tacggatacg 1380

gagacattca gacctgaagg aggaaatatg aaggacaatt ggagaagtga attatataaa 1440

tataaagtgg tagaagttaa gccattagga gtagcaccca ctaatgcaag aaggagagtg 1500

gtggagagag aaaaaagagc agtgggaatg ggagctgtgt tccttgggtt cttgggagcg 1560

gcaggaagca ctatgggcgc agcatcaata acgctgacgg tacaggccag acaattattg 1620

tctggtatag tgcaacagca aagcaatttg ctgaaggcta tagaggctca acagcatatg 1680

ttgaaactca cggtctgggg cattaaacag ctccaggcaa gagtcctggc cttggaaaga 1740

tacctaaagg atcaacagct cctagggatg tggggctgct ctggaaaact catctgcacc 1800

actaatgtat attggaactc tagttggagt aataaaactt atggtgatat ttgggataac 1860

atgacctgga tgcagtggga gagagaaatt agcaattata cagacataat atatgaattg 1920

cttgaagaat cacagaacca gcaggaaaag aatgaacaag atttactagc attggacaga 1980

tggaacagtc tgtggaattg gtttaacata acaaattggc tgtggtatat aaaaatattc 2040

ataatgatag taggaggctt gataggttta agaataattt ttgctgtgct ttctttagta 2100

aatagagtta ggcagggata ctcacctctg tcattgcaga cccttatccc aagcccgagg 2160

ggaccagaca ggcccggagg aatcgaagaa gaaggtggag agcaagacag aaacagatca 2220

acgcgattag tgagcggatt cttagcgctt gcctgggacg acctgcggag cctgtgcctt 2280

ttcatctacc accgattgaa agacttcata ttaattgcag cgagagcggg ggaacttctg 2340

ggacgcagca gtctcaaggg actacggaga gggtgggaag cccttaagta tctgggaagt 2400

cttgtgcagt attggggcct ggaactaaaa aggagtgcta ttagtctatt ggatacccta 2460

gcaatagcag taggtgaagg aacagatagg attctagaat ttgtattagg aatttgtaga 2520

gctatccgca acatacctac aagaataaga cagggctttg aaacagcttt gctataa 2577

<210> SEQ ID NO 74

<211> LENGTH: 2571

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 74

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaaaaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcatagtg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt agatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct aatgctactg ccagcaatag cagtataata 420

aagggaatga atagcagtat gatagaggaa atgaaaaatt gctctttcaa tataaccaca 480

gaattaagag ataagagaga gaaaaagaat gcactttttt ataaacttga tatagtacaa 540

ctagatggca actctagtca gtatagatta ataaattgta atacctcagt cataacacaa 600

gcctgtccaa aggtctcttt tgacccaatt cctatacatt attgtgctcc agctggttat 660

gcgattctaa agtgtaataa taagacattc aatggaacag gaccgtgtaa taatgtcagc 720

acagtacaat gtacacatgg aattaagcca gtggtttcaa ctcaactatt gttaaatggc 780

agcctagcag aaggagagat aataattaga tctgaaaata taacaaacag tgccaaaaca 840

ataatagtac atctcaatga atctgtaaag attgagtgta cgagacccag taataacaca 900

agaacaagta taagaatagg accaggacaa gcattttatg caacaggaca agtaatagga 960

gacataagaa aagcacattg taacattagt gaaagtaaat ggaatgaaac tttacaaagg 1020

gtaagtaaaa aattaaaaga atacttccct gataggaata taacatttca accatcctca 1080

ggaggggacc cagaaattac aacacatagc tttaattgtg gaggaaaatt tttctattgc 1140

aatacatcaa gcctgtttaa tagaacatat atggctaata gtacagatat ggctaatagt 1200

acagaaacta acagtacacg aatcatcaca atccgctgca gaataaaaca aattataaac 1260

atgtggcagg aggtgggacg agcaatgtat gcccctccca ttgcaggaaa cataacatgt 1320

atatcaaata tcacaggact actattgaca agggatggag gaaataacaa tacggagaca 1380

ttcagacctg taggaggaaa tatgaaggac aattggagaa gtaaattata taaatataaa 1440

gtggtagaag ttaagccatt aggagtagca cccactaagg caagaaggag aatggtggag 1500

agagaaaaaa gagcagtggg aatgggagct gtgttccttg ggttcttggg agcggcagga 1560

agcactatgg gcgcagcatc aataacgctg acggtacagg ccagacaatt attgtctggt 1620

atagtgcaac agcaaagcaa tttgctgaag gctatagagg ctcaacagca tatgttgaaa 1680

ctcacggtct ggggcattaa acagctccag gcaagagtcc tggccttgga aagataccta 1740

aaggatcaac agctcctagg gatgtggggc tgctctggaa aactcatctg caccactaat 1800

gtatattgga actctagttg gagtaataaa acttatggtg atatttggga taacatgacc 1860

tggatgcagt gggagagaga aattagcaat tatacagaaa taatatatga cttgcttgaa 1920

gaatcacaaa accagcagga aaagaatgaa caagatttac tagcattgga cagatggaac 1980

agtctgtgga attggtttaa cataacaaaa tggctgtggt atataaaaat attcataatg 2040

atagtaggag gcttgatagg tttaaaaata atttttgctg tgctttcttt agtaaataga 2100

gttaggcagg gatactcacc tctgtcgttg cagaccctta tcccaagccc gaggggacca 2160

gacaggcccg gaggaatcga agaagaaggt ggagagcaag acagaaacag atcaacgcga 2220

ttagtgagcg gattcttagc gcttgcctgg gacgacctgc ggagcctgtg ccttttcatc 2280

taccaccgat tgagagactt tatattaatt gcagcgagag cgggggaact tctgggacgc 2340

agcagtctca agggactacg gagaggatgg gaagccctta agtatctgga aggtcttgtg 2400

cagtattggg gcctggaact aaaaaggagt gctattagtc tattggatac cctagcaata 2460

gcagtaggtg aaggaacaga taggattcta gaatttgtat taggaatttg tagagctatc 2520

cgcaacatac ctacaagaat aagacagggc tttgaaacag ctttgctata a 2571

<210> SEQ ID NO 75

<211> LENGTH: 2589

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 75

atgagagtga tggggaggca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt agatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct aatgctactg ccagcaatac caatgctact 420

gccagcaata tcaatgctac tgccagcaag aacagtataa tagaggaaat gaaaaattgc 480

tctttcaata taaccacaga attaagagat aagagagaga aaaagtatgc acttttttat 540

aaacttgata tagtacaact agatggcaac tctagtcagt atagattaat aaattgtaat 600

acctcagtca taacacaagc ctgtccaaag gtctcttttg acccaattcc tatacattat 660

tgtgctccag ctggttatgc gattctaaag tgtaataata agacattcaa tggaacagga 720

ccgtgtaata atgtcagcac agtacaatgt acacatggaa ttaagccagt ggtttcaact 780

caactattgt taaatggtag cctagcagaa ggagagataa taattagatc taaaaatata 840

acagacaatg gcaaaacaat aatagtacat ctcaatgaat ctgtaaagat tgaatgtacg 900

agacccagta ataacacaag aacaagtata agaataggac caggacaagc attttatgca 960

acaggacaag taataggaga cataagagaa gcacattgta acattagtga aagtaaatgg 1020

aatgaaactt tacaaagggt aagtaaaaaa ttaaaagaat acttccctga taagaatata 1080

acatttcaat catcctcagg aggggaccca gaaattacaa cacatagctt taattgtgga 1140

ggagaatttt tctattgcaa tacatcaagc ctgtttaata ggacatatat ggctaatagt 1200

acagatatgg ctaatagtac agaaactaac agtacacgaa tcatcacaat ccgctgcaga 1260

ataaaacaaa ttataaacat gtggcaggag gtgggacgag caatgtatgc ccctcccatt 1320

gcaggaaaca taacatgtat atcaaatatc acaggactac tattgacaag ggatggagga 1380

aacagcagta cggagacatt cagacctgaa ggaggaaata tgaaggacaa ttggagaagt 1440

gaattatata aatataaagt ggtagaagtt aagccattag gagtagcacc cactaatgca 1500

agaaggagag tggtggagag agaaaaaaga gcagtgggaa tgggagctgt gttccttggg 1560

ttcttgggag cggcaggaag cactatgggc gcagcatcaa taacgctgac ggtacaggcc 1620

agacaattat tgtctggtat agtgcaacag caaagcaatt tgctgaaggc tatagaggct 1680

caacagcata tgttgaaact cacggtctgg ggcattaaac agctccaggc aagagtcctg 1740

gccttggaaa gatacctaaa ggatcaacag ctcctaggga tgtggggctg ctctggaaaa 1800

ctcatctgca ccactaatgt atattggaac tctagttgga gtaataaaac ttatgatgat 1860

atttgggata acatgacctg gatgcagtgg gagagagaaa ttagcaatta tacagaaatg 1920

atatatgact tgcttgaaga atcacaaaac cagcaggaaa agaatgaaca agatttacta 1980

gcattggaca gatggaacag tctgtggaat tggtttaaca taacaaaatg gctgtggtat 2040

ataaaaatat tcataatgat agtaggaggc ttgataggtt taagaataat ttttgctgta 2100

ctttctttag taaatagagt taggcaggga tactcacctc tgtcgttgca gacccttatc 2160

ccaagcccga ggggaccaga caggcccgga ggaatcgaag aagaaggtgg agagcaagac 2220

agaaagagat caacgcgatt agtgagcgga ttcttagcgc ttgtctggga cgacctgcgg 2280

agcctgtgcc ttttcatcta ccaccgattg agagacttca tattaattgc agcgagagcg 2340

ggggaacttc tgggacgcag cagtctcaag ggactacgga gagggtggga agcccttaag 2400

tatctgggaa gtcttgtgca gtattggggc ctggaactaa aaaggagtgc tattagttta 2460

ttggataccc tagcaatagc agtaggtgaa ggaacagata ggattctaga atttgtatta 2520

ggaatttgta gagctatccg caacatacct acaagaataa gacagggctt tgaaacagct 2580

ttgctataa 2589

<210> SEQ ID NO 76

<211> LENGTH: 2604

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 76

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgacttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggccac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt agatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct aatgctactg ccagcaatac caatgctact 420

gccagcaata tcaatgctac tgccagcaag agcagtataa tagaggaaat gaaaaattgc 480

tctttcaata taaccacaga attaagagat aagagagaga aaaagtatgc acttttttat 540

aaacttgata tagtacaact agatggcaac tctagtcagt atagattaat aaattgtaat 600

acctcagtca taacccaagc ctgtccaaag gtctcttttg acccaattcc tatacattat 660

tgtgctccag ctggttatgc gattctaaag tgtaataata agacattcaa tggaacagga 720

ccgtgtaata atgtcagcac agtacaatgt acacatggaa ttaagccagt ggtttcaact 780

caactattgt taaatggtag cctagcagaa ggagagataa taattagatc taaaaatata 840

acagacaatg gcaaaacaat aatagtacat ctcaatgaat ctgtaaagat tgaatgtacg 900

agacccagta ataacacaag aacaagtata agaataggac caggacaagc attttatgca 960

acaggacaag taataggaga cataagagaa gcacattgta acattagtga aagtaaatgg 1020

aatgaaactt tacaaagggt aagtaaaaaa ttaaaagaat acttccctga taagaatata 1080

acatttcaat catcctcagg aggggaccca gaaattacaa cacatagctt taattgtgga 1140

ggagaatttt tctattgcaa tacatcaagc ctgtttaata ggacatatat ggctaatagt 1200

acagatatgg ctaatagtac agaaactaac agtacacgaa tcatcacaat ccactgcaga 1260

ataaaacaaa ttataaacat gtggcaggag gtgggacgag caatgtatgc ccctcccatt 1320

gcaggaaaca taacatgtat atcaaatatc acaggactac tattgacaag ggatggagga 1380

gaaaacaatg gaggaaaaaa caatacagag acattcagac ctggaggagg aaatatgaag 1440

gacaattgga gaagtgaatt atataaatat aaagtggtag aagttaagcc attaggagta 1500

gcacccacta aggcaagaag gagagtggtg gagagagaaa aaagagcagt gggaatggga 1560

gctgtgttcc ttgggttctt gggagcggca ggaagcacta tgggcgcagc atcaataacg 1620

ctgacggtac aggccagaca attattgtct ggtatagtgc aacagcaaag caatttgctg 1680

aaggctatag aggctcaaca gcatatgttg aaactcacgg tctggggcat taaacagctc 1740

caggcaagag tcctggcctt ggaaagatac ctaaaggatc aacagctcct agggatgtgg 1800

ggctgctctg gaaaactcat ctgcaccact aatgtatatt ggaactctag ttggagtaat 1860

aaaacttatg gtgatatttg ggataacatg acctggatgc agtgggagag agaaattagc 1920

aattatacag acataatata tgacttgctt gaagaatcac aaaaccagca ggaaaagaat 1980

gaacaagatt tactagcatt ggacagatgg aacagtctgt ggaattggtt taacataaca 2040

aaatggctgt ggtatataaa aatattcata atgatagtag gaggcttgat aggtttaaga 2100

ataatttttg ctgtgctttc tttagtaaat agagttaggc agggatactc acctctgtca 2160

ttgcagaccc ttatcccaag cccgagggga ccagacaggc ccggaggaat cgaagaagaa 2220

ggtggagagc aagacagaaa cagatcaacg cgattagtga gcggattctt agcgcttgcc 2280

tgggacgacc tgcggagcct gtgccttttc atctaccacc gattgagaga cttcatatta 2340

attgcagcga gagcggggga acttctggga cgcagcagtc tcaagggact acggagaggg 2400

tgggaagccc ttaagtatct gggaggtctt gtgcagtatt ggggcctgga actaaaaagg 2460

agtgctatta gtctattgga taccctagca atagcagtag gtgaaggaac agataggatt 2520

ctagaatttg tattaggaat ttgtagagct atccgcaaca tacctacaag aataagacag 2580

ggctttgaaa cagctttgct ataa 2604

<210> SEQ ID NO 77

<211> LENGTH: 2571

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 77

acgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggc ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct aatgctactg ccagcaatat caatgctact 420

gccagcaaga gcagtataat agaggaaatg aaaaattgct ctttcaatat aaccacagaa 480

ttaagagata agagagagaa aaagtatgca cttttttata aacttgatat agtacaacta 540

gatggcaact ctagtcagta tagattaata aattgtaata cctcagtcat aacccaagcc 600

tgtccaaagg tctcttttga cccaattcct atacattatt gtgctccagc tggttatgcg 660

attctaaagt gtaataataa gacattcaat ggaacaggac cgtgtaataa tgtcagcaca 720

gtacaatgta cacatggaat taagccagtg gtttcaactc aactattgtt aaatggtagc 780

ctagcagaag gagagataat aattagatct gaaaatataa cagacaatag caaaacaata 840

atagtacatc tcaatgaatc tgtaaagatt gagtgtacaa gacccagtaa taacacaaga 900

acaagtataa gaataggacc aggacaagca ttttatgcaa caggacaagt aataggagac 960

ataagagaag cacattgtaa cattagtgaa agtaaatgga atgaaacttt acaaagggta 1020

agtaaaaaat taaaagaata cttccctgat aagaatataa catttcaacc atcctcagga 1080

ggggacccag aaattacaac acatagcttt aattgtggag gagaattttt ctattgcaat 1140

acatcaagcc tgtttaatag gacatacatg gctaatagta cagaaactaa cagtacacga 1200

accatcacac tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg agaaaacaca agggatggag gaaataacaa tacggagaca 1380

ttcagacctg aaggaggaaa tatgaaggac aattggagaa gtgaattata taaatataaa 1440

gtggtagaag ttaagccatt aggagtagca cccactaagg caagaaggag agtggtggag 1500

agagaaaaaa gagcagtggg aatgggagct gtgttccttg ggttcttggg agcggcagga 1560

agcactatgg gcgcagcatc aataacgctg acggtacagg ccaggcaatt attgtctggt 1620

atagtgcaac agcaaagcaa tttgctgaag gctatagagg ctcaacagca tatgttgaaa 1680

ctcacggtct ggggcattaa acagctccag gcaagagtcc tggccttgga aagataccta 1740

aaggatcaac agctcctagg gatgtggggc tgctctggaa aactcatctg caccactaat 1800

gtatattgga actctagttg gagtaataaa acttatggtg atatttggga taacatgacc 1860

tggatgcagt gggagagaga aattagcaat tatacagaca taatatatga attgcttgaa 1920

gaatcacaaa accagcagga aaagaatgaa caagatttac tagcattgga cagatggaac 1980

agtctgtgga attggtttaa cataacaaat tggctgtggt atataaaaat attcataatg 2040

atagtaggag gcttgatagg tttaagaata atttttgctg tgctttcttt agtaaataga 2100

gttaggcagg gatactcacc tctgtcattg cagaccctta tcccaagccc gaggggacca 2160

gacaggcccg gaggaatcga agaagaaggt ggagagcaag acagaaacag atcaacgcga 2220

ttagtgagcg gattcttagc gcttgcctgg gacgacctgc ggagcctgtg ccttttcatc 2280

taccaccgat tgagagactt catattaatt gcagcgagag cgggggaact tctgggacgc 2340

agcagtctca agggactacg gagagggtgg gaagccctta agtatctggg aagtcttgtg 2400

cagtattggg gcctggaact aaaaaggagt gctattagtc tattggatac cctagcaata 2460

gcagtaggtg aaggaacaga taggattcta gaatttgtat taggaatttg tagagctatc 2520

cgcaacatac ctacaagaat aagacagggc tttgaaacag ctttgctata a 2571

<210> SEQ ID NO 78

<211> LENGTH: 2592

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 78

atgaaagtga gggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctattatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttagaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggc ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct aatgctactg ccagcaatac caatgctact 420

gccagcaata tcaatgctac tgccagcaag agcagtataa tagaggaaat gaaaaattgc 480

tctttcaata taaccacaga attaagagat aagagagaga aaaagtatgc acttttttat 540

aaacttgata tagtacaact agatggcaac tctagtcagt atagattaat aaattgtaat 600

acctcagtca taacccaagc ctgtccaaag gtctcttttg acccaattcc tatacattat 660

tgtgctccag ctggttatgc gattctaaag tgtaataata agacattcaa tggaacagga 720

ccgtgtaata atgtcagcac agtacaatgt acacatggaa ttaagccagt ggtttcaact 780

caactattgt taaatggtag cctagcagaa ggagagataa taattagatc tgaaaatata 840

acagacaata gcaaaacaat aatagtacat ctcaatgaat ctgtaaagat tgagtgtaca 900

agacccagta ataacacaag aacaagtata aggataggac caggacaagc attttatgca 960

acaggacaag taataggaga cataagagaa gcacattgta acattagtga aagtaaatgg 1020

aatgaaactt tacaaagggt aagtaaaaaa ttaaaagaat acttccctga taagaatata 1080

acatttcaac catcctcagg aggggaccca gaaattacaa cacatagctt taattgtgga 1140

ggagaatttt tctattgcaa tacatcaagc ctgtttaata ggacatacat ggctaatagt 1200

acagaaacta acagtacacg aaccatcaca ctccactgca gaataaaaca aattataaac 1260

atgtggcagg aggtgggacg agcaatgtat gcccctccca ttgcagggaa cataacatgt 1320

atatcaaata tcacaggact actattgaca agggatggag gagaaaacac aagggatgga 1380

ggaaataaca atacggagac attcagacct gaaggaggaa atatgaagga caattggaga 1440

agtgaattat ataaatataa agtggtagaa gttaagccat taggagtagc acccactaag 1500

gcaagaagga gagtggtgga gagagaaaaa agagcagtgg gaatgggagc tgtgttcctt 1560

gggttcttgg gagcggcagg aagcactatg ggcgcagcat caataacgct gacggtacag 1620

gccagacaat tattgtctgg tatagtgcaa cagcaaagca atttgctgaa ggctatagag 1680

gctcaacagc atatgttgaa actcacggtc tggggcatta aacagctcca ggcaagagtc 1740

ctggccttgg aaagatacct aaaggatcaa cagctcctag ggatgtgggg ctgctctgga 1800

aaactcatct gcaccactaa tgtatattgg aactctagtt ggagtaataa aacttatggt 1860

gatatttggg ataacatgac ctggatgcag tgggagagag aaattagcaa ttatacagac 1920

ataatatatg acttgcttga agaatcacaa aaccagcagg aaaagaatga acaagattta 1980

ctagcattgg acagatggaa cagtctgtgg aattggttta acataacaaa atggctgtgg 2040

tatataaaaa tattcataat gatagtagga ggcttgatag gtttaagaat aatttttgct 2100

gtgctttctt tagtaaatag agttaggcag ggatactcac ctctgtcgtt acagaccctt 2160

atcccaagcc cgaggggacc agacaggccc ggaggaatcg aagaagaagg tggagagcaa 2220

gacagaaaca gatcaacgcg attagtgagc ggattcttag cgcttgcctg ggacgacctg 2280

cggagcctgt gccttttcat ctaccaccga ttgagagact tcatattaat tgcagcgaga 2340

gcgggggaac ttctgggacg cagcagtctc aagggactac ggagagggtg ggaagccctt 2400

aagtatctgg gaggtcttgt gcagtattgg ggcctggaac taaaaaggag tgctattagt 2460

ctattggata ccctagcaat agcagtaggt gaaggaacag ataggattct agaatttgta 2520

ttaggaattt gtagagctat ccgcaacata cctacaagaa taagacaggg ctttgaaaca 2580

gctttgctat aa 2592

<210> SEQ ID NO 79

<211> LENGTH: 2592

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 79

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gcgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggc ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct aatgctactg ccagcaatgc taatgctact 420

gccagcaata ccaatgctac tgtcagcaat agcagtataa tagaggaaat gaaaaattgc 480

tctttcaata taaccacaga attaagagat aagagagaga aaaagtatgc acttttttat 540

aaacttgata tagtacaact agatggcaac tctagtcagt atagattaat aaattgtaat 600

acctcagtca taacccaagc ctgtccaaag gtctcttttg acccaattcc tatacattat 660

tgtgctccag ctggttatgc gattctaaag tgtaataata agacattcaa tggaacagga 720

ccgtgtaata atgtcagcac agtacaatgt acacatggaa ttaagccagt ggtttcaact 780

caactactgt taaatggtag cctagcagaa ggagagataa taattagatc tgaaaatata 840

acaaacagtg ccaaaacaat aatagtacat ctcaatgaat ctgtaaagat tgagtgtacg 900

agacccagta ataacacaag aacaagtata agaataggac caggacaagc attttatgca 960

acaggacaag taataggaga cataagaaaa gcacattgta acattagtga aagtaaatgg 1020

aatgaaactt tacaaagggt aagtaaaaaa ttaaaagaat acttccctca taagaatata 1080

acatttcaac catcctcagg aggggaccca gaaattacaa cgcatagttt taattgtgga 1140

ggagaatttt tctattgcaa tacatcaagc ctgtttaata ggacatacat ggctaatagt 1200

acagaaacta acagtacacg aaccatcaca ctccactgca gaataaaaca aattataaac 1260

atgtggcagg aggtgggacg agcaatgtat gcccctccca ttgcaggaaa cataacatgt 1320

atatcaaata tcacaggact actattgaca agggatggag gagaaaacac aagggatgga 1380

ggaaataaca atacggagac attcagacct ggaggaggaa atatgaagga caattggaga 1440

agtgaattat ataaatataa agtggtagaa gttaagccat taggagtagc acccactaat 1500

gcaagaagga gagtggtgga gagagaaaaa agagcagtgg gaatgggagc tgtgttcctt 1560

gggttcttgg gagcggcagg aagcactatg ggcgcagcat caataacgct gacggtacag 1620

gccagacaat tattgtctgg tatagtgcaa cagcaaagca atttgctgaa ggctatagag 1680

gctcaacagc atatgttgaa actcacggtc tggggcatca aacagctcca ggcaagagtc 1740

ctggccttgg aaagatacct aaaggatcaa cagctcctag ggatgtgggg ctgctctgga 1800

aaactcatct gcaccactaa tgtatattgg aactctagtt ggagtaataa aacttatggt 1860

gatatttggg ataacatgac ctggatgcag tgggagagag aaattagcaa ttatacagac 1920

ataatatatg acttgcttga agaatcacaa aaccagcagg aaaagaatga acaagattta 1980

ctagcattgg acagatggaa cagtctgtgg aattggttta acataacaaa atggctgtgg 2040

tatataaaaa tattcataat gatagtagga ggcttgatag gtttaagaat aatttttgct 2100

gtgctttctt tagtaaatag agttaggcag ggatactcac ctctgtcgtt gcagaccctt 2160

atcccaagcc cgaggggacc agacaggccc ggaggaatcg aagaagaagg tggagagcaa 2220

gacagaaaca gatcaacgcg attagtgagc ggattcttag cgcttgcctg ggacgacctg 2280

cggagcctgt gccttttcat ctaccaccga ttgagagact tcatattaat tgcagcgaga 2340

gcgggggaac ttctgggacg cagcagtctc aagggactac ggagaggatg ggaagccctt 2400

aagtatctgg gaggtcttgt gcagtattgg ggcctggaac taaaaaggag tgctattagt 2460

ctattggata ccctagcaat agcagtaggt gaaggaacag ataggattct agaatttgta 2520

ttaggaattt gtagagctat ccgcaacata cctacaagaa taagacaggg ctttgaaaca 2580

gctttgctat aa 2592

<210> SEQ ID NO 80

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 80

atgagagtga tggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaattttaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgcgtca ctctaagctg tatcaatgct actaatgcta ctgacagcaa taacagtata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac tatatggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tactcatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat ggcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatctag cctgtttaat 1140

aggacatata tggctactag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgaagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agttggagta ataaaactta tagtgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac agacatgata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgggcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaggga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 81

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 81

atgagagtga gggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaattttaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgccagcaa tagcaatata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctaatag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacac tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgaagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agctggagta ataaaactta tagtgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac agacatgata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctggaacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaggga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacggctttg ctataa 2556

<210> SEQ ID NO 82

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 82

acgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgacagcaa tagcaatata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gactgagact ttacaaaggg taagtgaaaa attaaaaaaa 1020

tacttccctg ataagaatat aacatttcga ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctactag tacagatatg gctaatagta cagaaattaa cagtacacga 1200

atcatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgaagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agctggagta ataaaactta tgatgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac aaacataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaggga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 83

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 83

atgagagtga gggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctattatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgacagcaa tagcaatata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgagact ttacaaaggg taagtgaaaa attaaaaaaa 1020

tacttccctg ataagaatat aacatttcga ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctactag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgaagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agctggagta ataaaactta tgatgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac aaacataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaggga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 84

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 84

atgagagtga gggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgacagcaa tagcaatata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgagact ttacaaaggg taagtgaaaa attaaaaaaa 1020

tacttccctg ataagaatat aacatttcga ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctactag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgaagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agctggagta ataaaactta tgatgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac aaacataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaggga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 85

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 85

atgagagtga gggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgacagcaa tagcaatata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgagact ttacaaaggg taagtgaaaa attaaaaaaa 1020

tacttccctg ataagaatat aacatttcga ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctactag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgaagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agctggagta ataaaactta tgatgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac aaacataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaatataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaggga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 86

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 86

atgagagtga gggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgacagcaa tagcaatata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aaggcattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgagact ttacaaaggg taagtgaaaa attaaaaaaa 1020

tacttccctg ataagaatat aacatttcga ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctactag tacagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacaa tccattgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgaagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agctggagta ataaaactta tgatgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac aaacataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaagga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ttataa 2556

<210> SEQ ID NO 87

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 87

atgagagtga gggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggagagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgacagcaa tagcaatata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagataat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgagact ttacaaaggg taagtaaaaa attaaaaaaa 1020

tacttccctg ataagaatat aacatttcga ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctactag tatagatatg gctaatagta cagaaactaa cagtacacga 1200

atcatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgaagga 1380

ggaaatatga aggacaattg gagaagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agctggagta ataaaactta tgatgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac aaacataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa ataaagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaagga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 88

<211> LENGTH: 2559

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 88

atgagagtga tggggacaca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggc ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctatactg tatcaatgct actgccaatg ctactgtcag caatagcagt 420

ataatagagg aaatgaaaaa ttgctctttc aatataacca cagaattaag agataagaga 480

gagaaaaaga atgcactttt ttataaactt gatatagtac aactagatgg caactctagt 540

cagtatagat taataaattg taatacctca gccataacac aagcctgtcc aaaggtctct 600

tttgacccaa ttcctataca ttattgtgct ccagctggtt atgcgattct aaagtgtaat 660

aataagacat tcaatggaac aggaccgtgt aataatgtca gcacagtaca atgtacacat 720

ggaattaagc cagtggtttc aacccaacta ttgttaaatg gtagcctagc agaaggagag 780

ataataatta gatctgaaaa tataacaaac agtgccaaaa caataatagt acatctcaat 840

gaatctgtaa agattgagtg tacgagaccc agtaataaca caagaacaag tataagaata 900

ggaccaggac aagcatttta tgcaacagga caagtaatag gagacataag acaagcacat 960

tgtaacatta gtgaaagtaa atggaatgaa actttacaaa gggtaagtga aaaattaaaa 1020

gaatacttcc ctaataagac tataacattt caaccatcct caggagggga cccagaaatt 1080

acaacacata gctttaattg tggaggagaa tttttctatt gcaatacatc aagcctgttt 1140

aataggacat atatggctaa tagtacagat atggctaata gtacagaaac taacagtaca 1200

cgaaccatca cactccactg cagaataaaa caaattataa acatgtggca agaggtggga 1260

cgagcaatgt atgcccctcc cattgcagga aacataacat gtatatcaaa tatcacagga 1320

ctactattga caagggatgg aggaaacagc agtaaggaga cagagacatt cagacctgga 1380

ggaggaaata tgaaggacaa ttggagaagt gaattatata aatataaagt ggtagaagtt 1440

aagccattag gagtagcacc cactaatgca agaaggagag tggtggagag agaaaaaaga 1500

gcagtgggaa tgggagctgt gttccttggg ttcttgggag cggcaggaag cactatgggc 1560

gcagcatcaa taacgctgac ggtacaggcc agacaattat tgtctggtat agtgcaacag 1620

caaagcaatt tgctgaaggc tatagaggct caacagcata tgttgaaact cacggtctgg 1680

ggcattaaac agctccaggc aagagtcctg gccttggaaa gatacctaaa ggatcaacag 1740

ctcctaggga tgtggggctg ctctggaaaa ctcatctgca ccactaatgt atattggaac 1800

tctagttgga gtaataaaac ttatggtgat atttgggata acatgacctg gatgcagtgg 1860

gagagagaaa ttagcaatta tacagaccta atatatgact tgcttgaaga atcacaaaac 1920

cagcaggaaa agaatgaaca agatttatta gcattggaca gatggaacag tctgtggaat 1980

tggtttaaca taacaaaatg gctgtggtat ataaaaatat tcataatgat agtaggaggc 2040

ttgataggtt taagaataat ttttgctgtg ctttctttag taaatagagt taggcaggga 2100

tactcacctc tgtcgttgca gacccttatc ccaagcccga ggggaccaga caggcccgga 2160

ggaatcgaag aagaaggtgg agagcaagac agaaacagat caacgcgatt agtgagcgga 2220

ttcttagcgc ttgcctggga cgacctgcgg agcctgtgcc ttttcctcta ccaccgattg 2280

agagacttca tattaattgc agcgagagcg ggggaacttc tgggacgcag cagtctcaag 2340

ggactacgga gagggtggga agcccttaag tatctgggag gtcttgtgca gtattggggc 2400

ctggaactaa aaaggagtgc tattagtcta ttggataccc tagcaatagc agtaggtgaa 2460

ggaacagata ggattctaga atttgtatta ggaatttgta gagctatccg caacatacct 2520

acaagaataa gacagggctt tgaaacagct ttgctataa 2559

<210> SEQ ID NO 89

<211> LENGTH: 2574

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 89

atgagagtga gggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gcgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt agatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct aatgctactg ccagcaatac caatgctact 420

gtcagcaata tcaaggctac tgtcagcaat agcagtataa tagaggaaat gaaaaattgc 480

tctttcaata taaccacaga attaagagat aagatagaga aaaagtatgc acttttttat 540

aaacttgata tagtacaact agatggcaac tctactcagt atagattcat aaattgtaat 600

acctcagcca taacacaagc ctgtccaaag gtctcttttg acccaattcc tatacattat 660

tgtgctccag ctggttatgc gattctaaag tgtaataata agacattcaa tggaacagga 720

ccgtgtaata atgtcagcac agtacaatgt acacatggaa ttaagccagt ggtttcaact 780

caactattgt taaatggtag cctagcagaa ggagagataa taattagatc tgaaaatata 840

acagacaatg gcaaaacaat aatagtacat ctcaatgaat ctgtaaagat tgagtgtacg 900

agacccggca ataacacaag aacaagtata agaataggac caggacaagc attttatgca 960

acaggacaag taataggaga cataagacaa gcacattgta acattagtga aagtaaatgg 1020

aatgaaactt tacaaagggt aagtgaaaaa ttaaaagaat acttccctaa taagactata 1080

acatttcaac catcctcagg aggggaccca gaaattacaa cacatagctt taattgtgga 1140

ggagaatttt tttattgcaa tacatcaagc ctgtttaata ggacatacat ggctaatagt 1200

acagaaacta acagtacacg aaccatcaca ctccactgca gaataaaaca aattataaac 1260

atgtggcagg aggtgggacg agcaatgtat gcccctccca ttgcaggaaa cataacatgt 1320

atatcaaata tcacaggact actattgaca agggatggag gaaacactac ggatatagag 1380

acattcagac ctggaggagg aaatatgaag gacaattgga gaagtgaatt atataaatat 1440

aaagtggtag aagttaagcc attaggagta gcacccacta aggcaagaag gagagtggtg 1500

gagagagaaa aaagagcagt gggaatggga gctgtgttcc ttgggttctt gggagcggca 1560

ggaagcacta tgggcgcagc atcgataacg ctgacggtac aggccagaca attattgtct 1620

ggtatagtgc aacagcaaag caatttgctg aaggctatag aggctcaaca gcatatgttg 1680

aaactcacgg tctggggcat taaacagctc caggcaagag tcctggcctt ggaaagatac 1740

ctaaaggatc aacagctcct agggatgtgg ggctgctctg gaaaactcat ctgcaccact 1800

aatgtatatt ggaactctag ttggagtaat aaaacttatg atgatatttg ggataacatg 1860

acctggatgc agtgggagag agaaattagc aattacacag aaataatata tgacttgctt 1920

gaagaatcac aaaaccagca ggaaaagaat gaacaagatt tactagcatt ggacaggtgg 1980

aacagtctgt ggaattggtt taacataaca aaatggctgt ggtatataaa aatattcata 2040

atgatagtag gaggcttgat aggtttaaga ataatttttg ctgtgctttc tttagtaaat 2100

agagttaggc agggatactc acctctgtcg ttgcagaccc ttatcccaag cccgagggga 2160

ccagacaggc ccggaggaat cgaagaagaa ggtggagagc aagacagaaa cagatcaacg 2220

cgattagtga gcggattctt agcgcttgcc tgggacgacc tgcggagcct gtgccttttc 2280

atctaccacc gattgagaga cttcatatta attgcagcga gagcggggga acttctggga 2340

cgcagcagtc tcaagggact acggagaggg tgggaagccc ttaagtatct gggaggtatt 2400

gtgcagtatt ggggcctgga actaaaaagg agtgctatta gtctattgga taccctagca 2460

atagcagtag gtgaaggaac agataggatt ctagaatttg tattaggaat ttgtagagct 2520

atccgcaaca tacctacaag aataagacag ggctttgaaa cagctttgct ataa 2574

<210> SEQ ID NO 90

<211> LENGTH: 2580

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 90

atgagagtga gggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gcgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt agatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct aatgctactg ccagcaatgc taatgctact 420

gccagcaata ccaatgctac tgtcagcaat gatagcagta taatagagga aatgaaaaat 480

tgctctttca atataaccac agaattaaga gataagatag agaaaaagta tgcacttttt 540

tataaacttg atatagtaca actagatggc aactctactc agtatagatt cataaattgt 600

aatacctcag ccataacaca agcctgtcca aaggtctctt ttgacccaat tcctatacat 660

tattgtgctc cagctggtta tgcgattcta aagtgtaata ataagacatt caatggaaca 720

ggaccgtgta ataatgtcag cacagtacaa tgtacacatg gaattaagcc agtggtttca 780

actcaactat tgttaaatgg tagcctagca gaaggagaga taataattag atctaaaaac 840

ataacagaca atggcaacac aataatagta catctcaatg aatctgtaaa gattgagtgt 900

acgagaccca gtaataacac aagaacaagt ataagaatag gaccaggaca agcattttat 960

gcaacaggac aagtaatagg agacataaga caagcacatt gtaacattag tgaaagtaaa 1020

tggaatgaaa ctttacaaag ggtaagtgaa aaattaaaag aatacttccc tgataagaat 1080

ataacatttc aaccatcctc aggaggggac ccagaaatta caacacatag ctttaattgt 1140

ggaggagaat ttttttattg caatacatca agcctgttta ataggacata catggctaat 1200

agtacagaaa ctaacagtac acgaaccatc acactccact gcagaataaa acaaattata 1260

aacatgtggc aagaggtggg acgagcaatg tatgcccctc ccattgcagg aaacataaca 1320

tgtatatcaa atatcacagg actactattg acaagggatg gaggaaacag cagtaaggag 1380

acagagacat tcagacctgg aggaggaaat atgaaggaca attggagaag tgaattatat 1440

aaatataaag tggtagaagt taagccatta ggagtagcac ccactaatgc aagaaggaga 1500

gtggtggaga gagaaaaaag agcagtggga atgggagctg tgttccttgg gttcttggga 1560

gcggcaggaa gcactatggg cgcagcatca ataacgctga cggtacaggc cagacaatta 1620

ttgtctggta tagtgcaaca gcaaagcaat ttgctgaagg ctatagaggc tcaacagcat 1680

atgttgagac tcacggtctg gggcattaaa cagctccagg caagagtcct ggccttggaa 1740

agatacctaa aggatcaaca gctcctaggg atgtggggct gctctggaaa actcatctgc 1800

accactaatg tatattggaa ctctagttgg agtaataaaa cttatagtga tatttgggat 1860

aacatgacct ggatgcagtg ggagggagaa attagcaatt atacagaaat aatatataac 1920

ttgcttgaag aatcacaaaa ccagcaggaa aagaatgaac aagatttact agcattggac 1980

agatggaaca gtctgtggaa ttggtttaac ataacaaagt ggctgtggta tataaaaata 2040

ttcataatga tagtaggagg cttgataggt ttaagaataa tttttgctgt gctttcttta 2100

gtaaatagag ttaggcaggg atactcacct ctgtcgttgc agacccttat cccaagcccg 2160

aggggaccag acaggcccgg aggaatcgaa gaagaaggtg gagagcaaga cagaaagaga 2220

tcaacgcgat tagtgagcgg attcttagcg cttgtctggg acgacctgcg gagcctgtgc 2280

cttttcctct accaccgatt gagagacttc atattaattg cagcgagagc gggggaactt 2340

ctgggacgca gcagtctcaa gggactacgg agagggtggg aagcccttaa gtatctggga 2400

agtcttgtgc agtattgggg cctggaacta aaagggagtg ctattagtct attggatacc 2460

ctagcaatag cagtaggtga aggaacagat aggattctag aatttgtatt aggaatttgt 2520

agagctatcc gcaacatacc cacaagaata agacagggct ttgaaacagc tttgctataa 2580

<210> SEQ ID NO 91

<211> LENGTH: 2577

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 91

atgagagtga tggggagaca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcacgc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct aatgatactg ccagcaatag cagtataata 420

aagggaatga ataacagtat agtaggggaa atgaaaaatt gctctttcaa tataaccaca 480

gaattaagag ataagagaga gaaaaagaat gcactttttt ataaacttga tatagtacaa 540

ctagatggca actctagtga gtatagatta ataaattgta atacctcagt cataacacaa 600

gcctgtccaa aggtctcttt tgacccaatt cctatacatt attgtgctcc agctggttat 660

gcgattctaa agtgtaataa taagacattc aatggaacag gaccgtgtaa taatgtcagc 720

acagtacaat gtacacatgg aattaagcca gtggtttcaa ctcaactatt gttaaatggt 780

agcctagcag aaggagagat aataattaga tctgaaaata taacagacaa tgccaaaaca 840

ataatagtac atctcaatga atctgtaaag attgagtgta cgagacccag taataacaca 900

agaacaagta taagaatagg accaggacaa gcattttatg caacaggaca agtaatagga 960

gacataagaa aagcacattg taacattagt gaaagtaaat ggaatgaaac tttacaaagg 1020

gtaagtaaaa aattaaaaga atacttccct gataagaata taacatttca accatcctca 1080

ggaggggacc cagaaattac aacacatagc tttaattgtg gaggagaatt tttctattgc 1140

aatacatcaa gcctgtttaa taggacatat atggctaata gtacagatat ggctaatagt 1200

gcagaaacta acagtacaag aaccatcaca ctccactgca gaataaaaca aattataaac 1260

atgtggcagg aggtgggacg agcaatgtat gcccctccca ttgcaggaaa cataacatgt 1320

atatcaaata tcacaggact actattgaca agggatggag gaaacagcag tacggagaca 1380

gagacattca gacctggagg aggaaatatg aaggacaatt ggagaagtga attatataaa 1440

tataaagtgg tagaagttaa gccattagga gtagcaccca ctaatgcaag aaggagagtg 1500

gtggagagag aaaaaagagc agtgggaatg ggagctgtgt tccttgggtt cttgggagcg 1560

gcaggaagca ctatgggcgc agcatcaata acgctgacgg tacaggccag acaattattg 1620

tctggcatag tgcaacagca aagcaatttg ctgaaggcta tagaggctca acagcatatg 1680

ttgagactca cggtctgggg cattaaacag ctccaggcaa gagtcctggc cttggaaaga 1740

tacctaaagg atcaacagct cctagggatg tggggctgct ctggaaaact catctgcacc 1800

actaatgtat attggaactc tagttggagt aataaaactt atgatgatat ttgggataac 1860

atgacctgga tgcagtggga gggagaaatt agcaattata caaacataat atatgacttg 1920

cttgaagaat cacaaaacca gcaggaaaag aatgaacaag atttactagc attggacaga 1980

tggaacagtc tgtggaattg gtttaacata acaaattggc tgtggtatat aaaaatattc 2040

ataatgatag taggaggctt gataggttta agaataattt ttgctgtgct ttctttagta 2100

aatagagtta ggcagggata ctcacctctg tcgttgcaga cccttatccc aagcccgagg 2160

ggaccagaca ggcccggagg aatcgaagaa gaaggtggag agcaagacag aaagagatca 2220

acgcgattag tgagcggatt cttagcgctt gtctgggacg acctgcggag cctgtgcctt 2280

ttcctctacc accgattgag agacttcata ttaattgcag cgagagcggg ggaacttctg 2340

ggacgcagca gtctcaaggg actacggaga gggtgggaag cccttaagta tctgggaagt 2400

cttgtgcagt attggggcct ggaactaaaa aggagtgcta ttagtctatt ggatacccta 2460

gcaatagcag taggtgaagg aacagatagg attctagaat ttgtattagg aatttgtaga 2520

gctatccgca acatacctac aagaataaga cagggctttg aaacagcttt gctataa 2577

<210> SEQ ID NO 92

<211> LENGTH: 2553

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 92

atgagagtga gggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgacagcaa aagcaatata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctaactct 540

agtcagtata gattaataaa ttgtaatacc tcagtcataa cacaagcctg tccaaaggtc 600

tcttttgacc caattcctat acattattgt gctccagctg gttatgcgat tctaaagtgt 660

aataataaga cattcaatgg aacaggaccg tgtaataatg tcagcacagt acaatgtact 720

catggaatta agccagtggt ttcaactcaa ctattgttaa atggtagcct agcagaagga 780

gagataataa ttagatctaa aaatataaca gacaatagca aaacaataat agtacatctc 840

aatgaatctg taaagattga gtgtacgaga cccagtaata acacaagaac aagtataaga 900

ataggaccag gacaagcatt ttatgcaaca ggacaagtaa taggaaatat aagagaagca 960

cattgtaaca ttagtgaaag taaatggaat gaaactttac aaagggtaag tgaaaaatta 1020

aaagaatact tccctcaaaa gaatataacc tttcaaccat cctcaggagg ggacctagaa 1080

attacaacac atagctttaa ttgtggagga gaatttttct attgcaatac atcaagcctg 1140

tttaatagga catatatggc tactggtaca gatatggcta atagtacaga aactaacatc 1200

atcacaatcc actgcagaat aaaacaaatt ataaacatgt ggcaggaggt gggacgagca 1260

atgtatgccc ctcccattgc aggaaacata acatgtatat caaatatcac aggactacta 1320

ttgacaaggg atggaggaaa cagtacagag gatacggaga cattcagacc tgtaggagga 1380

aatatgaagg acaattggag cagtgaatta tataaatata aagtggtaga agttaagcca 1440

ttaggagtag cacccactaa tgcaagaagg agagtggtgg agagagaaaa aagagcagtg 1500

ggaatgggag ctgtgttcct tgggttcttg ggagcggcag gaagcactat gggcgcagca 1560

tcaataacgc tgacggtaca ggccagacaa ttattgtctg gtatagtgca acagcaaagc 1620

aatttgctga aggctataga ggctcaacag catatgttga aactcacggt ctggggcatt 1680

aaacagctcc aggcaagagt cctggccttg gaaagatacc taaaggatca acagctccta 1740

gggatgtggg gctgctctgg aaaactcatc tgcaccacta atgtatattg gaactctagc 1800

tggagtaata aaacttatga tgatatttgg gataacatga cctggatgca gtgggagaga 1860

gaaattagca attatacaaa cataatatat gaattgcttg aagaatcaca aaaccagcag 1920

gaaaagaatg aacaagattt actagcattg gacagatgga acagtctgtg gaattggttt 1980

aacataacaa attggctgtg gtatataaaa atattcataa tgatagtagg aggcttgata 2040

ggtttaagaa taatttttgc tgtgctttct ttagtaaata gagttaggca gggatactca 2100

cctctgtcat tgcagaccct tatcccaagc ccgaggggac cagacaggcc cggaggaatc 2160

gaagaagaag gtggagagca agacagaaac agatcaacgc gattagtgag cggattctta 2220

gcgcttgcct gggacgacct gcggagcctg tgccttttca tctaccaccg attgagagac 2280

ttcatattaa ttgcagcgag agcgggggaa cttctgggac gcagcagtct caagggacta 2340

cggagagggt gggaagccct taagtatctg ggaagtcttg tgcagtattg gggcctggaa 2400

ctaaaaagga gtgctattag tctattggat accctagcaa tagcagtagg tgaaggaaca 2460

gataggattc tagaatttgt attaggaatt tgtagagcta tccgcaacat acctacaaga 2520

ataagacagg gctttgaaac agctttgctg taa 2553

<210> SEQ ID NO 93

<211> LENGTH: 2547

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 93

atgagagtga gggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaag gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgccagcga tagcagtata 420

ttagatggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgagact ttacaaaggg taagtgaaaa attaaaaaaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctactag tacagatttg gctaatagta cagaaactaa catcatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaacaatac agaggatacg gagacattca gacctgtagg aggaaatatg 1380

aaggacaatt ggagcagtga attatataaa tataaagtgg tagaagttaa gccattagga 1440

gtagcaccca ctaatgcaag aaggagagtg gtgaagagag aaaaaagagc agtgggaatg 1500

ggagctatgt tccttgggtt cttgggagcg gcaggaagca ctatgggcgc agcatcaata 1560

acgctgacgg tacaggccag acaattattg tctggtatag tgcaacagca aagcaatttg 1620

ctgaaggcta tagaggctca acagcatatg ttgaaactca cggtctgggg cattaaacag 1680

ctccaggcaa gagtcctggc cttggaaaga tacctaaagg atcaacagct cctagggatg 1740

tggggctgct ctggaaaact catctgcacc actaatgtat attggaactc tagctggagt 1800

aataaaactt atgatgatat ttgggataac atgacctgga tgcagtggga gagagaaatt 1860

agcaattata cagaactaat atatgaattg cttgaagaat cacaaaacca gcaggaaaag 1920

aatgaacaag atttactagc attggacaga tggaacagtc tgtggaattg gtttaacata 1980

acaaattggc tgtggtatat aaaaatattc ataatgatag taggaggctt gataggttta 2040

agaataattt ttgctgtgct ttctttagta aatagagtta ggcagggata ctcacctctg 2100

tcattgcaga cccttatccc aagcccgagg ggaccagaca ggcccggagg aatcgaagaa 2160

gaaggtggag agcaagacag aaacagatca acgcgattag tgagcggatt cttagcgctt 2220

gcctgggacg acctgcggag cctgtgcctt ttcatctacc accgattgag agacttcata 2280

ttaattgcag cgagagcggg ggaacttctg ggacgcagca gtctcaaggg actacggaga 2340

gggtgggaag cccttaagta tctgggaagt cttgtgcagt attggggcct ggaactaaaa 2400

aggagtgcta ttagtctatt ggatacccta gcaatagcag taggtgaggg aacagatagg 2460

attctagaat ttgtattagg aatttgtaga gctatccgca acatacctac aagaataaga 2520

cagggctttg aaacagcttt gctataa 2547

<210> SEQ ID NO 94

<211> LENGTH: 2592

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 94

atgagagtga tggggagaca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttgtggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaaggata tgagaaggaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct aatgctactg ccagcaatgc taatgctact 420

gtcagcaata ccaatgctac tgtcagcaat gatagcagta taatagagga aatgaaaaat 480

tgctctttca atataaccac agaattaaga gataagatag agaaaaagta tgcacttttt 540

tataaacttg atatagtaca actagatggc aactctactc attatagatt cataaattgt 600

aatacctcag ccataacaca agcctgtcca aaggtctctt ttgacccaat tcctatacat 660

tattgtgctc cagctggtta tgcgattcta aagtgtaata ataagacatt caatggaaca 720

ggaccgtgta ataatgtcag cacagtacaa tgtacacatg gaattaagcc agtggtttca 780

actcaactat tgttaaatgg tagcctagca gaaggagaga taataattag atctaaaaat 840

ataacagaca atggcaaaac aataatagta catctcaatg aatctgtaaa gattgagtgt 900

acgagaccca gtaataacac aagaacaagt ataggaatag gaccaggaca agcattttat 960

gcaacaggac aagtaatagg agacataaga aaagcacatt gtaacattag tgaaagtaaa 1020

tggaatgaaa ctttacaaag ggtaagtaaa aaattaaaag aatacttccc tggtaagaat 1080

ataacatttc aaccatcctc aggaggggac ccagaagtta caacacatag ctttaattgt 1140

ggaggagaat ttttctattg caatacatca agcctgttta atagaacata tatgactaat 1200

agtacagata tggctaatag tacagaaact aacagaacca tcacaatcca ctgcagaata 1260

aaacaaatta taaacatgtg gcaggaggtg ggacgagcaa tgtatgcccc tcccattgca 1320

ggaaacataa catgtatatc aaatatcaca ggactactat tgacaaggga tggaggaaac 1380

agcagtacgg agacagagac attcagacct gaaggaggaa atatgaagga caattggaga 1440

agtgaattat ataaatataa agtggtagaa gttaagccat taggagtagc acccactaat 1500

gcaagaagga gagtggtgga gagagaaaaa agagcagtgg gaatgggagc tgtgttcctt 1560

gggttcttgg gagcggcagg aagcactatg ggcgcagcat caataacgct gacggtacag 1620

gccagacaat tattgtctgg catagtgcaa cagcaaagca atttgctgaa ggctatagag 1680

gctcaacagc atatgttgag actcacggtc tggggcatta aacagctcca agcaagagtc 1740

ctggccttgg aaagatacct aaaggatcaa cagctcctag ggatgtgggg ctgctctgga 1800

aaactcatct gcaccactaa tgtatattgg aactctagtt ggagtaataa aacttatgat 1860

gatatttggg ataacatgac ctggatgcag tgggagggag aaattagcaa ttatacaaac 1920

ataatatatg acttgcttga agaatcacaa aaccagcagg aaaagaatga acaagattta 1980

ctagcattgg acagatggaa cagtctgtgg aattggttta acataacaaa gtggctgtgg 2040

tatataaaaa tattcataat gatagtagga ggcttgatag gtttaagaat aatttttgct 2100

gtgctttctt tagtaaatag agttaggcag ggatactcac ctctgtcgtt gcagaccctt 2160

atcccaagcc cgaggggacc agacaggccc ggaggaatcg aagaagaagg tggagagcaa 2220

gacagaaaga gatcaacgcg attagtgagc ggattcttag cgcttgtctg ggacgacctg 2280

cggagcctgt gccttttcct ctaccaccga ttgagagact tcatattaat tgcagcgaga 2340

gcgggggaac ttctgggacg cagcagtctc aagggactac gaagagggtg ggaagccctt 2400

aagtatctgg gaagtcttgt gcagtattgg ggcctggaac taaaagggag tgctattagt 2460

ctattggata ccctagcaat agcagtaggt gaaggaacag ataggattct agaatttgta 2520

ttaggaattt gtagagctat ccgcaacata cccacaagaa taagacaggg ctttgaaaca 2580

gctttgctat aa 2592

<210> SEQ ID NO 95

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 95

atgagagtga gggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaattttaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgacagcaa aagcaatata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtagcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgttagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctaatag tacagatatg gctaatagta cagaaactaa cagtacacaa 1200

atcatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgtagga 1380

ggaaatatga aggacaattg gagcagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agctggagta ataaaactta tgatgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac aaacataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtacagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaggga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 96

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 96

atgagagtga gggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgccagcga tagcagtata 420

ttagatggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtagcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctg ataagaaaat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctaatag tacagatatg gctaatagta cagaaactaa cagtacacaa 1200

atcatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgtagga 1380

ggaaatatga aggacaattg gagcagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agttggagta ataaaactta tgatgatatt tgggataaca tgacctggat gcaatgggag 1860

agagaaatta gcaattatac agaaataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtacagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaggga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 97

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 97

atgagagtga gggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaattttaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgacagcaa aagcaatata 420

ttagagggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accatgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctaatag tacagatatg gctaatagta cagaaactaa cagtacacaa 1200

atcatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgtagga 1380

ggaaatatga aggacaattg gagcagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taaggcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agctggagta ataaaactta tgatgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac aaacataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaggga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 98

<211> LENGTH: 2547

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 98

atgagagtga gggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ctttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaag gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgccagcga tagcagtata 420

ttagatggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgagact ttacaaaggg taagtgaaaa attaaaaaaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctactag tacagatatg gctaatagta cagaaactaa catcatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaacaatac agaggatacg gagacattca gacctgtagg aggaaatatg 1380

aaggacaatt ggagcagtga attatataaa tataaagtgg tagaagttaa gccattagga 1440

gtagcaccca ctaatgcaag aaggagagtg gtggagagag aaaaaagagc agtgggaatg 1500

ggagctgtgt tccttgggtt cttgggagcg gcaggaagca ctatgggcgc agcatcaata 1560

acgctgacgg tacaggccag acaattattg tctggtatag tgcaacagca aagcaatttg 1620

ctgaaggcta tagaggctca acagcatatg ttgaaactca cggtctgggg cattaaacag 1680

ctccaggcaa gagtcctggc cttggaaaga tacctaaagg atcaacagct cctagggatg 1740

tggggctgct ctggaaaact catctgcacc actaatgtat attggaactc tagctggagt 1800

aataaaactt atagtgatat ttgggataac atgacctgga tgcagtggga gagagaaatt 1860

agcaattata cagacatgat atatgaattg cttgaagaat cacaaaacca gcaggaaaag 1920

aatgaacaag atttactagc attggacaga tggaacagtc tgtggaattg gtttaacata 1980

acaaattggc tgtggtatat aaaaatattc ataatgatag taggaggttt gataggttta 2040

agaataattt ttgctgtgct ttctttagta aatagagtta ggcagggata ctcacctctg 2100

tcattgcaga cccttatccc aagcccgagg ggaccagaca ggcccggagg aatcgaagaa 2160

gaaggtggag agcaagacag aaacagatca acgcgattag tgagcggatt cttagcgctt 2220

gcctgggacg acctgcggag cctgtgcctt ttcatctacc accgattgag agacttcata 2280

ttaattgcag cgagagcggg ggaacttctg ggacgcagca gtctcaaggg actacggaga 2340

gggtgggaag cccttaagta tctgggaagt cttgtgcagt attggggcct ggaactaaaa 2400

aggagtgcta ttagtctatt ggatacccta gcaatagcag taggtgaggg aacagatagg 2460

attctagaat ttgtattagg aatttgtaga gctatccgca acatacctac aagaataaga 2520

cagggctttg aaacagcttt gctataa 2547

<210> SEQ ID NO 99

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 99

atgagagtga gggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgccagcga tagcagtata 420

ttagatggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtagcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctaatag tacagatatg gctaatagta cagaaactaa cagtacacaa 1200

atcatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgtagga 1380

ggaaatatga aggacaattg gagcagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agttggagta ataaaactta tgatgatatt tgggataaca tgacctggat gcaatgggag 1860

agagaaatta gcaattatac agaaataata tatgaattgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct gtggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtacagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaggga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 100

<211> LENGTH: 2556

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 100

atgagagtga gggggataca gaggagttat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacgg accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg tatcaatgct actaatgcta ctgccagcga tagcagtata 420

ttagatggaa tgaaaaattg ctctttcaat ataaccacag aattaagaga taagagagag 480

aaaaagaatg cactttttta taaacttgat atagtacaac taggtggcaa ctctagtcag 540

tatagattaa taaattgtaa tacctcagtc ataacacaag cctgtccaaa ggtctctttt 600

gacccaattc ctatacatta ttgtgctcca gctggttatg cgattctaaa gtgtaataat 660

aagacattca atggaacagg accgtgtaat aatgtcagca cagtacaatg tacacatgga 720

attaagccag tggtttcaac tcaactattg ttaaatggta gcctagcaga aggagagata 780

ataattagat ctaaaaatat aacagacaat agcaaaacaa taatagtaca tctcaatgaa 840

tctgtaaaga ttgagtgtac gagacccagt aataacacaa gaacaagtat aagaatagga 900

ccaggacaag cattttatgc aacaggacaa gtaataggaa atataagaga agcacattgt 960

aacattagtg aaagtaaatg gaatgaaact ttacaaaggg taagtgaaaa attaaaagaa 1020

tacttccctg ataagaatat aacatttcaa ccatcctcag gaggggacct agaaattaca 1080

acacatagct ttaattgtgg aggagaattt ttctattgca atacatcaag cctgtttaat 1140

aggacatata tggctaatag tacagatatg gctaatagta cagaaactaa cagtacacaa 1200

atcatcacaa tccactgcag aataaaacaa attataaaca tgtggcagga ggtgggacga 1260

gcaatgtatg cccctcccat tgcaggaaac ataacatgta tatcaaatat cacaggacta 1320

ctattgacaa gggatggagg aaacaataca gaggatacgg agacattcag acctgtagga 1380

ggaaatatga aggacaattg gagcagtgaa ttatataaat ataaagtggt agaagttaag 1440

ccattaggag tagcacccac taatgcaaga aggagagtgg tggagagaga aaaaagagca 1500

gtgggaatgg gagctgtgtt ccttgggttc ttgggagcgg caggaagcac tatgggcgca 1560

gcatcaataa cgctgacggt acaggccaga caattattgt ctggtatagt gcaacagcaa 1620

agcaatttgc tgaaggctat agaggctcaa cagcatatgt tgaaactcac ggtctggggc 1680

attaaacagc tccaggcaag agtcctggcc ttggaaagat acctaaagga tcaacagctc 1740

ctagggatgt ggggctgctc tggaaaactc atctgcacca ctaatgtata ttggaactct 1800

agctggagta ataaaactta tagtgatatt tgggataaca tgacctggat gcagtgggag 1860

agagaaatta gcaattatac agacatgata tatgaactgc ttgaagaatc acaaaaccag 1920

caggaaaaga atgaacaaga tttactagca ttggacagat ggaacagtct atggaattgg 1980

tttaacataa caaattggct gtggtatata aaaatattca taatgatagt aggaggcttg 2040

ataggtttaa gaataatttt tgctgtgctt tctttagtaa atagagttag gcagggatac 2100

tcacctctgt cattgcagac ccttatccca agcccgaggg gaccagacag gcccggagga 2160

atcgaagaag aaggtggaga gcaagacaga aacagatcaa cgcgattagt gagcggattc 2220

ttagcgcttg cctgggacga cctgcggagc ctgtgccttt tcatctacca ccgattgaga 2280

gacttcatat taattgcagc gagagcgggg gaacttctgg gacgcagcag tctcaaggga 2340

ctacggagag ggtgggaagc ccttaagtat ctgggaagtc ttgtgcagta ttggggcctg 2400

gaactaaaaa ggagtgctat tagtctattg gataccctag caatagcagt aggtgaggga 2460

acagatagga ttctagaatt tgtattagga atttgtagag ctatccgcaa catacctaca 2520

agaataagac agggctttga aacagctttg ctataa 2556

<210> SEQ ID NO 101

<211> LENGTH: 2589

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 101

atgagagtga tggggagaca gaggaattat ccacaatggt ggatatggag cacgttaggc 60

ttgcggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtgggaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccgatgct aatgctactg ccagcaatgc taatgctact 420

gtcagcaata ccaatgctac tgtcagcaat gatagcagta taatagagga aatgaaaaat 480

tgctctttca atataaccac agaattaaga gataagatag agaaaaagta tgcacttttt 540

tataaacttg atatagtaca actagatggc aactctactc attatagatt cataaattgt 600

aatacctcag ccataacaca agcctgtcca aaggtctctt ttgacccaat tcctatacat 660

tattgtgctc cagctggtta tgcgattcta aagtgtaata ataagacatt caatggaaca 720

ggaccgtgta ataatgtcag cacagtacaa tgtacacatg gaattaagcc agtggtttca 780

actcaactat tgttaaatgg tagcctagca gaaggagaga taataattag atctgaaaat 840

ataacagaca atgccaaaac aataatagta catctcaatg aatctgtaaa gattgagtgt 900

acgagaccca gtaataacac aagaacaagt ataggaatag gaccaggaca agcattttat 960

gcaacaggac aagtaatagg agacataaga aaagcacatt gtaacattag tgaaagtaaa 1020

tggaatgaaa ctttacaaag ggtaagtaaa aaattaaaag aatacttccc tggtaagaat 1080

ataacatttc aaccatcctc aggaggggac ccagaagtta caacacatag ctttaattgt 1140

ggaggagaat ttttctattg caatacatca agcctgttta ataggacata tatgactaat 1200

agtacagata tggctaatag tacagaaact aacagaacca tcacaatcca ctgcagaata 1260

aaacaaatta taaacatgtg gcaagaggtg ggacgagcaa tgtatgcccc tcccattgca 1320

ggaaacataa catgtatatc aaatatcaca ggactactat tgacaaggga tggaggaaac 1380

aatacggatc cggagatatt cagacctgga ggaggaaata tgaaggacaa ttggagaagt 1440

gaattatata aatataaagt ggtagaagtt aagccattag gagtagcacc cactaatgca 1500

agaaggagag tggtggagag agaaaaaaga gcagtgggaa tgggagctgt gttccttggg 1560

ttcttgggag cggcaggaag cactatgggc gcagcgtcaa taacgctgac ggtacaggcc 1620

agacaactat tgtctggtat agtgcaacag caaagcaatt tgctgaaggc tatagaggct 1680

caacagcaca tgttgagact cacggtctgg ggcattaaac agctccaggc aagagtcctg 1740

gccttggaaa gatacctaaa ggatcaacag ctcctaggga tgtggggctg ctctggaaaa 1800

ctcatttgca ccactaatgt atattggaac tctagttgga gtaataaaac ttatggtgat 1860

atttgggata acatgacctg gatgcagtgg gagagcgaaa ttagcaatta tacaaacata 1920

atatatgatt tgcttgaaga atcacaaaac cagcaggaaa agaatgaaca agatttacta 1980

gcattggaca gatggaacag tctgtggaat tggtttaaca taacaaaatg gctgtggtat 2040

ataaaaatat tcataatgat agtaggaggc ttgataggtt taagaataat ttttgctgtg 2100

ctttctttag taaatagagt taggcaggga tactcacctc tgtcgttgca gacccttatc 2160

ccaagcccga ggggaccaga caggcccgga ggaatcgaag aagaaggtgg agagcaagac 2220

agaaagagat caacgcgatt agtgagcgga ttcttagcgc ttgtctggga cgacctgcgg 2280

agcctgtgcc ttttcctcta ccaccgattg agagacttca tattaattgc agcgagagcg 2340

ggggaacttc tgggacgcag cagtctcaag ggactacgga gagggtggga agcccttaag 2400

tatctgggaa gtcttgtgca gtattggggc ctggaactaa aaaggagtgc tattagtcta 2460

ttggataccc tagcaatagc agtaggtgaa ggaacagata ggattctaga atttgtatta 2520

ggaatttgta gagctatccg caacatacct acaagaataa gacagggctt tgaaacagct 2580

ttgctataa 2589

<210> SEQ ID NO 102

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 102

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaaaaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 103

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 103

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgacaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 104

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 104

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tggcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 105

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 105

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacagacaa tggcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 106

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 106

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctaaaaata taacagacaa tggcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 107

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 107

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctaaaaata taacagacaa tagcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 108

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 108

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacag tggcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 109

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 109

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacag tgccaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 110

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 110

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacac tgccaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 111

<211> LENGTH: 2541

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 111

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgccaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag aagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcctca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acagtacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tacggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag ctttgctata a 2541

<210> SEQ ID NO 112

<211> LENGTH: 2542

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 112

atgagagtga tggggataca gaggaattat ccacaatggt ggatatggag catgttaggc 60

ttttggatgc taatgatttg taatgggatg tgggtcacag tctactatgg ggtacctgtg 120

tggaaagaag caaaaactac tctattttgt gcatcagatg ctaaagcata tgagaaagaa 180

gtgcataatg tctgggctac acatgcctgt gtacccacag accccaatcc acaagaaatg 240

gttttaaaaa atgtaacaga aaatttcaac atgtggaaaa atgacatggt ggatcagatg 300

catgaagatg taattagttt atgggatcaa agcctcaagc catgtgtaaa gttgacccca 360

ctctgtgtca ctctaaactg taccaatgct actgccagca atagcagtat aatagaggga 420

atgaaaaatt gctctttcaa tataaccaca gaattaagag ataagagaga gaaaaagaat 480

gcactttttt ataaacttga tatagtacaa ctagatggca actctagtca gtatagatta 540

ataaattgta atacctcagt cataacacaa gcctgtccaa aggtctcttt tgacccaatt 600

cctatacatt attgtgctcc agctggttat gcgattctaa agtgtaataa taagacattc 660

actggaacag gaccgtgtaa taatgtcagc acagtacaat gtacacatgg aattaagcca 720

gtggtttcaa ctcaactatt gttaaatggt agcctagcag aaggagagat aataattaga 780

tctgaaaata taacaaacaa tgtcaaaaca ataatagtac atctcaatga atctgtaaag 840

attgagtgta cgagacccaa taataaaaca agaacaagta taagaatagg accaggacaa 900

gcattttatg caacaggaca agtaatagga gacataagag cagcatattg taacattaat 960

gaaagtaaat ggaatgaaac tttacaaagg gtaagtaaaa aattaaaaga atacttccct 1020

cataagaata taacatttca accatcccca ggaggggacc tagaaattac aacacatagc 1080

tttaattgtg gaggagaatt tttctattgc aatacatcaa gcctgtttaa taggacatat 1140

atggctaata gtacagatat ggctaatagt acagaaacta acaatacacg aaccatcaca 1200

atccactgca gaataaaaca aattataaac atgtggcagg aggtgggacg agcaatgtat 1260

gcccctccca ttgcaggaaa cataacatgt atatcaaata tcacaggact actattgaca 1320

agggatggag gaaaaaacaa tgcggagaca ttcagacctg gaggaggaaa tatgaaggac 1380

aattggagaa gtgaattata taaatataaa gtggtagaag ttaagccatt aggagtagca 1440

cccactaatg caagaaggag agtggtggag agagaaaaaa gagcagtggg aatgggagct 1500

gtgttccttg ggttcttggg agcggcagga agcactatgg gcgcagcatc aataacgctg 1560

acggtacagg ccagacaatt attgtctggt atagtgcaac agcaaagcaa tttgctgaag 1620

gctatagagg ctcaacagca tatgttgaaa ctcacggtct ggggcattaa acagctccag 1680

gcaagagtcc tggccttgga aagataccta aaggatcaac agctcctagg gatgtggggc 1740

tgctctggaa aactcatctg caccactaat gtatattgga actctagttg gagtaataaa 1800

acttatggtg atatttggga taacatgacc tggatgcagt gggagagaga aattagcaat 1860

tatacagaaa taatatatga attgcttgaa gaatcacaaa accagcagga aaagaatgaa 1920

caagatttac tagcattgga cagatggaac agtctgtgga attggtttaa cataacaaat 1980

tggctgtggt atataaaaat attcataatg atagtaggag gcttgatagg tttaagaata 2040

atttttgctg tgctttcttt agtaaataga gttaggcagg gatactcacc tctgtcgttg 2100

cagaccctta tcccaagccc gaggggacca gacaggcccg gaggaatcga agaagaaggt 2160

ggagagcaag acagaaacag atcaacgcga ttagtgagcg gattcttagc gcttgtctgg 2220

gacgacctgc ggagcctgtg ccttttcatc taccaccgat tgagagactt catattaatt 2280

gcagcgagag cgggggaact tctgggacgc agcagtctca agggactacg gagaggatgg 2340

gaagccctta agtatctggg aagtcttgtg cagtattggg gcctggaact aaaaaggagt 2400

gctattagtc tattggatac cctagcaata gcagtaggtg aaggaacaga taggattcta 2460

gaatttgtat taggaatttg tagagctatc cgcaacatac ctacaagaat aagacagggc 2520

tttgaaacag cttttgctat aa 2542

<210> SEQ ID NO 113

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 113

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aagaacgtga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtgacc gaattcggga 1500

cccggatcc 1509

<210> SEQ ID NO 114

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 114

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgcga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtcacc gaattcggga 1500

cccggatcc 1509

<210> SEQ ID NO 115

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 115

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtcgaa 780

gaacatcacg gacaactcga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtaacc gaattcggga 1500

cccggatcc 1509

<210> SEQ ID NO 116

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 116

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aactcggcga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggttacc gaattcggga 1500

cccggatcc 1509

<210> SEQ ID NO 117

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 117

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtcgaa 780

gaacatcacg gacaacggga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtgacc gaattcgggt 1500

cccggatcc 1509

<210> SEQ ID NO 118

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 118

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacggga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtgacc gaattcagga 1500

cccggatcc 1509

<210> SEQ ID NO 119

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 119

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg gacaacggga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtgacc gaattcaggt 1500

cccggatcc 1509

<210> SEQ ID NO 120

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 120

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgaca agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtgacc gaattcggga 1500

cctggatcc 1509

<210> SEQ ID NO 121

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 121

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aactcgggga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtgacc gaattcgggt 1500

cctggatcc 1509

<210> SEQ ID NO 122

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 122

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacacggcga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtcacc gaattcgggt 1500

cccggatcc 1509

<210> SEQ ID NO 123

<211> LENGTH: 1490

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 123

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgtga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagggatcc 1490

<210> SEQ ID NO 124

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 124

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aagaacgtga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtcacc gaattcggga 1500

cctggatcc 1509

<210> SEQ ID NO 125

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 125

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgtga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatccg 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtcacc gaattcgggt 1500

cctggatcc 1509

<210> SEQ ID NO 126

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 126

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgtcat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgtga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcaagatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtaacc gaattcgggt 1500

cccggatcc 1509

<210> SEQ ID NO 127

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 127

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatgttcct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agcggatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgtga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcgc ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatccg 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtaacc gaattcagga 1500

cccggatcc 1509

<210> SEQ ID NO 128

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 128

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

catcaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacggga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcatca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtaacc gaattcaggt 1500

cccggatcc 1509

<210> SEQ ID NO 129

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 129

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacggga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcatca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtaacc gaattcggga 1500

cctggatcc 1509

<210> SEQ ID NO 130

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 130

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgtga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcaagatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtaacc gaattcgggt 1500

cctggatcc 1509

<210> SEQ ID NO 131

<211> LENGTH: 1530

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 131

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaacacg aacgccacgg cctcgaactc 420

ctccacgatc gagggcatga agaactgctc cttcaacatc acgacggagc tgcgcgacaa 480

gcgcgagaag aagaacgccc tgttctacaa gctggacatc gtgcagctgg acggcaactc 540

ctcgcagtac aggctgatca actgcaacac ctccgtcatc acgcaggcgt gccccaaggt 600

gtccttcgac cccatcccca tccactactg cgcccccgcc ggctacgcca tcctgaagtg 660

caacaacaag accttcaccg gcaccggccc gtgcaacaac gtgtccaccg tgcagtgcac 720

gcacgggatc aagcccgtgg tgtccacgca gctgctcctg aacgggtcgc tggccgaggg 780

cgagatcatc atccggtccg agaacatcac gaacaacgcg aagaccatca tcgtgcacct 840

gaacgagtcc gtgaagatcg agtgcacccg cccgaacaac aagacgcgca cctccatccg 900

gatcggccct ggccaggcct tctacgccac cggccaggtg atcggcaaca tccgcgaggc 960

gtactgcaac atctcggagt ccaagtggaa cgagaccctg cagcgcgtgt ccaagaagct 1020

gaaggagtac ttcccccaca agaacatcac cttccagccg tcgtccggcg gcgacctcga 1080

gatcaccacg cactccttca actgcggtgg cgagttcttc tactgcaaca cgtcgtcgct 1140

gttcaaccgc acctacatgg ccaactccac cgacatggcc aactccaccg agaccaactc 1200

cacgcgcatc atcacgatcc actgccgcat caagcagatc atcaacatgt ggcaggaggt 1260

gggccgcgcc atgtacgcac cgcccatcgc cggcaacatc acctgcatct ccaacatcac 1320

cggcctcctg ctgacccgcg acggcggcaa gaacaacacg gagaccttca ggccaggcgg 1380

aggcaacatg aaggacaact ggcgctccga gctgtacaag tacaaggtgg tggaggtgaa 1440

gcccctgggc gtggcaccca ccaacgcccg cgagcgcgtc gtggagcgcg agaaggagta 1500

gtaaggttac cgaattcggg tcccggatcc 1530

<210> SEQ ID NO 132

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 132

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gaacaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacggga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tctcggagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatccg 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtcacc gaattcagga 1500

cccggatcc 1509

<210> SEQ ID NO 133

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 133

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaacgc gtccaacaac tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacggga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tctcggagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcatca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggttacc gaattcagga 1500

cccggatcc 1509

<210> SEQ ID NO 134

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 134

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gaacaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgcga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcaacat ccgcgaggcg tactgcaaca tctcggagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgctcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggttacc gaattcaggt 1500

cccggatcc 1509

<210> SEQ ID NO 135

<211> LENGTH: 1506

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 135

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccgcgtc caactcctcc atcatcgagg gcatgaagaa 420

ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga acgccctgtt 480

ctacaagctg gacatcgtgc agctggacgg caactcctcg cagtacaggc tgatcaactg 540

caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca tccccatcca 600

ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct tcaccggcac 660

cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc ccgtggtgtc 720

cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc ggtccgagaa 780

catcacgaac aacgcgaaga ccatcatcgt gcacctgaac gagtccgtga agatcgagtg 840

cacccgcccg aacaacaaga cgcgcacctc catccggatc ggccctggcc aggccttcta 900

cgccaccggc caggtgatcg gcgacatccg caaggcgtac tgcaacatca acgagtccaa 960

gtggaacgag accctgcagc gcgtgtccaa gaagctgaag gagtacttcc cccacaagaa 1020

catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact ccttcaactg 1080

cggtggcgag ttcttctact gcaacacgtc gtcgctgttc aaccgcacct acatggccaa 1140

ctccaccgac atggccaact ccaccgagac caacaacacg cgcaccatca cgatccactg 1200

ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt acgcaccgcc 1260

catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga cccgcgacgg 1320

cggcaagaac aacacggaga ccttcaggcc aggcggaggc aacatgaagg acaactggcg 1380

ctccgagctg tacaagtaca aggtggtgga ggtgaagccc ctgggcgtgg cacccaccaa 1440

cgcccgcgag cgcgtcgtgg agcgcgagaa ggagtagtaa ggttaccgaa ttcgggacct 1500

ggatcc 1506

<210> SEQ ID NO 136

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 136

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccac gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgtga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tccggaacat ccgcgaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcaagatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggttacc gaattcgggt 1500

cctggatcc 1509

<210> SEQ ID NO 137

<211> LENGTH: 1524

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 137

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaacgcc acggcctcga actcctccat 420

catcgagggc atgaagaact gctccttcaa catcacgacg gagctgcgcg acaagcgcga 480

gaagaagaac gccctgttct acaagctgga catcgtgcag ctggacggca actcctcgca 540

gtacaggctg atcaactgca acacctccgt catcacgcag gcgtgcccca aggtgtcctt 600

cgaccccatc cccatccact actgcgcccc cgccggctac gccatcctga agtgcaacaa 660

caagaccttc accggcaccg gcccgtgcaa caacgtgtcc accgtgcagt gcacgcacgg 720

gatcaagccc gtggtgtcca cgcagctgct cctgaacggg tcgctggccg agggcgagat 780

catcatccgg tccgagaaca tcacgaacaa cgtgaagacc atcatcgtgc acctgaacga 840

gtccgtgaag atcgagtgca cccgcccgaa caacaagacg cgcaagtcca tccggatcgg 900

ccctggccag gccttctacg ccaccggcca ggtgatcggc gacatccgcg aggcgtactg 960

caacatcaac gagtccaagt ggaacgagac cctgcagcgc gtgtccaaga agctgaagga 1020

gtacttcccc cacaagaaca tcaccttcca gccgtcgtcc ggcggcgacc tcgagatcac 1080

cacgcactcc ttcaactgcg gtggcgagtt cttctactgc aacacgtcgt cgctgttcaa 1140

ccgcacctac atggccaact ccaccgacat ggccaactcc accgagacca actccacgcg 1200

caccatcacg atccgctgcc gcatcaagca gatcatcaac atgtggcagg aggtgggccg 1260

cgccatgtac gcaccgccca tcgccggcaa catcacctgc atctccaaca tcaccggcct 1320

cctgctgacc cgcgacggcg gcaagaacaa cacggagacc ttcaggccag gcggaggcaa 1380

catgaaggac aactggcgct ccgagctgta caagtacaag gtggtggagg tgaagcccct 1440

gggcgtggca cccaccaacg cccgcgagcg cgtcgtggag cgcgagaagg agtagtaagg 1500

gacccgaatt cggtgaccgg atcc 1524

<210> SEQ ID NO 138

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 138

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaacaac tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgcga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac gtccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcaaggcg tactgcaaca tctcggagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgctcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagggaccc gaattcggtc 1500

accggatcc 1509

<210> SEQ ID NO 139

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 139

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccac gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgtga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tctcggagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaacaac acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagggaccc gaattcggta 1500

accggatcc 1509

<210> SEQ ID NO 140

<211> LENGTH: 1524

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 140

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaacgcc acggcctcga actcctccat 420

catcgagggc atgaagaact gctccttcaa catcacgacg gagctgcgcg acaagcgcga 480

gaagaagaac gccctgttct acaagctgga catcgtgcag ctggacggca actcctcgca 540

gtacaggctg atcaactgca acacctccgt catcacgcag gcgtgcccca aggtgtcctt 600

cgaccccatc cccatccact actgcgcccc cgccggctac gccatcctga agtgcaacaa 660

caagaccttc accggcaccg gcccgtgcaa caacgtgtcc accgtgcagt gcacgcacgg 720

gatcaagccc gtggtgtcca cgcagctgct cctgaacggg tcgctggccg agggcgagat 780

catcatccgg tccgagaaca tcacgaacaa cgtgaagacc atcatcgtgc acctgaacga 840

gtccgtgaag atcgagtgca cccgcccgaa caacaagacg cgcaagtcca tccggatcgg 900

ccctggccag gccttctacg ccaccggcca ggtgatcggc gacatccgcg aggcgtactg 960

caacatctcc gagtccaagt ggaacgagac cctgcagcgc gtgtccaaga agctgaagga 1020

gtacttcccc cacaagaaca tcaccttcca gccgtcgtcc ggcggcgacc tcgagatcac 1080

cacgcactcc ttcaactgcg gtggcgagtt cttctactgc aacacgtcgt cgctgttcaa 1140

ccgcacctac atggccaact ccaccgacat ggccaactcc accgagacca actccacgcg 1200

caccatcacg atccgctgcc gcatcaagca gatcatcaac atgtggcagg aggtgggccg 1260

cgccatgtac gcaccgccca tcgccggcaa catcacctgc atctccaaca tcaccggcct 1320

cctgctgacc cgcgacggcg gcaagaacaa cacggagacc ttcaggccag gcggaggcaa 1380

catgaaggac aactggcgct ccgagctgta caagtacaag gtggtggagg tgaagcccct 1440

gggcgtggca cccaccaacg cccgcgagcg cgtcgtggag cgcgagaagg agtagtaagg 1500

gacccgaatt cggttaccgg atcc 1524

<210> SEQ ID NO 141

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 141

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccac gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgtga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tctcggagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatccg 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg cggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagggtccc gaattcggtg 1500

accggatcc 1509

<210> SEQ ID NO 142

<211> LENGTH: 1510

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 142

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccac gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgcga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcaaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaacaac acgcgcacca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagaggacc cgaattcggt 1500

gaccggatcc 1510

<210> SEQ ID NO 143

<211> LENGTH: 1510

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 143

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccac gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgcga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcaaggcg tactgcaaca tcaacgagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatccg 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagaggtcc cgaattcggt 1500

gaccggatcc 1510

<210> SEQ ID NO 144

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 144

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaacatc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacggga agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tctcggagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcatca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagggacct gaattcggtg 1500

accggatcc 1509

<210> SEQ ID NO 145

<211> LENGTH: 1527

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 145

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacggc caacgccacc gcgtccaact cctccatcat 420

cgagggcatg aagaactgct ccttcaacat cacgacggag ctgcgcgaca agcgcgagaa 480

gaagaacgcc ctgttctaca agctggacat cgtgcagctg gacggcaact cctcgcagta 540

caggctgatc aactgcaaca cctccgtcat cacgcaggcg tgccccaagg tgtccttcga 600

ccccatcccc atccactact gcgcccccgc cggctacgcc atcctgaagt gcaacaacaa 660

gaccttcacc ggcaccggcc cgtgcaacaa cgtgtccacc gtgcagtgca cgcacgggat 720

caagcccgtg gtgtccacgc agctgctcct gaacgggtcg ctggccgagg gcgagatcat 780

catccggtcc gagaacatca cgaacaacgg gaagaccatc atcgtccagc tcaacgagtc 840

cgtgaagatc gagtgcaccc gcccgaacaa caagacgcgc acctccatcc ggatcggccc 900

tggccaggcc ttctacgcca ccggccaggt gatcggcaac atccgcgagg cgtactgcaa 960

catcagcgag tccaagtgga acgagaccct gcagcgcgtg tccaagaagc tgaaggagta 1020

cttcccccac aagaacatca ccttccagcc gtcgtccggc ggcgacctcg agatcaccac 1080

gcactccttc aactgcggtg gcgagttctt ctactgcaac acgtcgtcgc tgttcaaccg 1140

cacctacatg gccaactcca ccgacatggc caactccacc gagaccaact ccacgcgcat 1200

catcacgatc cactgccgca tcaagcagat catcaacatg tggcaggagg tgggccgcgc 1260

catgtacgca ccgcccatcg ccggcaacat cacctgcatc tccaacatca ccggcctcct 1320

gctgacccgc gacggcggca agaacaacac cgacacggag accttcaggc caggcggagg 1380

caacatgaag gacaactggc gctccgagct gtacaagtac aaggtggtgg aggtgaagcc 1440

cctgggcgtg gcacccacca acgcccgcga gcgcgtcgtg gagcgcgaga aggagtagta 1500

agggtcctga attcggtgac cggatcc 1527

<210> SEQ ID NO 146

<211> LENGTH: 1527

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 146

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacgac caacgccacc gcgtccaact cctccatcat 420

cgagggcatg aagaactgct ccttcaacat cacgacggag ctgcgcgaca agcgcgagaa 480

gaagaacgcc ctgttctaca agctggacat cgtgcagctg gacggcaact cctcgcagta 540

caggctgatc aactgcaaca cctccgtcat cacgcaggcg tgccccaagg tgtccttcga 600

ccccatcccc atccactact gcgcccccgc cggctacgcc atcctgaagt gcaacaacaa 660

gaccttcacc ggcaccggcc cgtgcaacaa cgtgtccacc gtgcagtgca cgcacgggat 720

caagcccgtg gtgtccacgc agctgctcct gaacgggtcg ctggccgagg gcgagatcat 780

catccggtcc gagaacatca cgaacaacgc gaagaccatc atcgtgcacc tgaacgagtc 840

cgtgaagatc gagtgcaccc gcccgagcaa caagacgcgc acctccatcc ggatcggccc 900

tggccaggcc ttctacgcca ccggccaggt gatcggcgac atccgcgagg cgtactgcaa 960

catcagcgag tccaagtgga acgagaccct gcagcgcgtg tccaagaagc tgaaggagta 1020

cttcccccac aagaacatca ccttccagcc gtcgtccggc ggcgacctcg agatcaccac 1080

gcactccttc aactgcggtg gcgagttctt ctactgcaac acgtcgtcgc tgttcaaccg 1140

cacctacatg gccaactcca ccgacatggc caactccacc gagaccaact ccacgcgcac 1200

catcacgatc cggtgccgca tcaagcagat catcaacatg tggcaggagg tgggccgcgc 1260

catgtacgca ccgcccatcg ccggcaacat cacctgcatc tccaacatca ccggcctcct 1320

gctgacccgc gacggcggca agaacaacac ggacacggag accttcaggc caggcggagg 1380

caacatgaag gacaactggc gctccgagct gtacaagtac aaggtggtgg aggtgaagcc 1440

cctgggcgtg gcacccacca acgcccgcga gcgcgtcgtg gagcgcgaga aggagtagta 1500

agggtcccga attcggtcac cggatcc 1527

<210> SEQ ID NO 147

<211> LENGTH: 1528

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 147

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacggc gaacgccacc gcgtccaact cctccatcat 420

cgagggcatg aagaactgct ccttcaacat cacgacggag ctgcgcgaca agcgcgagaa 480

gaagaacgcc ctgttctaca agctggacat cgtgcagctg gacggcaact cctcgcagta 540

caggctgatc aactgcaaca cctccgtcat cacgcaggcg tgccccaagg tgtccttcga 600

ccccatcccc atccactact gcgcccccgc cggctacgcc atcctgaagt gcaacaacaa 660

gaccttcaac ggcaccggcc cgtgcaacaa cgtgtccacc gtgcagtgca cgcacgggat 720

caagcccgtg gtgtccacgc agctgctcct gaacgggtcg ctggccgagg gcgagatcat 780

catccggtcc gagaacatca cgaacaacgt gaagaccatc atcgtgcacc tgaacgagtc 840

cgtgaagatc gagtgcaccc gcccgaacaa caagacgcgc acctccatcc ggatcggccc 900

tggccaggcc ttctacgcca ccggccaggt gatcggcgac atccgcgagg cgcactgcaa 960

catcagcgag tccaagtgga acaagaccct gcagcgcgtg tccaagaagc tgaaggagta 1020

cttcccccac aagaacatca ccttccagcc gtcgtccggc ggcgacctcg agatcaccac 1080

gcactccttc aactgcggtg gcgagttctt ctactgcaac acgtcgtcgc tgttcaaccg 1140

cacctacatg gccaactcca ccgacatggc caactccacc gagaccaact ccacgcgcac 1200

catcacgatc cggtgccgca tcaagcagat catcaacatg tggcaggagg tgggccgcgc 1260

catgtacgca ccgcccatcg ccggcaacat cacctgcatc tccaacatca ccggcctcct 1320

gctgacccgc gacggcggca agaacaacac cgacacggag accttcaggc caggcggagg 1380

caacatgaag gacaactggc gctccgagct gtacaagtac aaggtggtgg aggtgaagcc 1440

cctgggcgtg gcacccacca acgcccgcga gcgcgtcgtg gagcgcgaga aggagtagta 1500

agaggacccg aattcggtca ccggatcc 1528

<210> SEQ ID NO 148

<211> LENGTH: 1510

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 148

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccac gtccaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgaca agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca acacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tctcggagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcatca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagaggtcc cgaattcggt 1500

caccggatcc 1510

<210> SEQ ID NO 149

<211> LENGTH: 1497

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 149

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aagggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gtccaacatc tccatcgagg agatgaagaa 420

ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga acgccctgtt 480

ctacaagctg gacatcgtgc agctggacgg caactcctcg cagtacaggc tgatcaactg 540

caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca tccccatcca 600

ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct tcaccggcac 660

cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc ccgtggtgtc 720

cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc ggtccgagaa 780

catcacggac aacgtgaaga ccatcatcgt gcacctgaac gagtccgtga agatcgagtg 840

cacccgcccg aacaacaaga cgcgcacctc catccggatc ggccctggcc aggccttcta 900

cgccaccggc caggtgatcg gcgacatccg cgaggcgtac tgcaacatct cggagtccaa 960

gtggaacgag accctgcagc gcgtgtccaa gaagctgaag gagtacttcc cccacaagaa 1020

catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact ccttcaactg 1080

cggtggcgag ttcttctact gcaacacgtc gtcgctgttc aaccgcacct acatggccaa 1140

caactccacc gagaccaact ccacgcgcac catcacgatc cggtgccgca tcaagcagat 1200

catcaacatg tggcaggagg tgggccgcgc catgtacgca ccgcccatcg ccggcaacat 1260

cacctgcatc tccaacatca ccggcctcct gctgacccgc gacggcggca agaacaacac 1320

cgacacggag accttcaggc caggcggagg caacatgaag gacaactggc gctccgagct 1380

gtacaagtac aaggtggtgg aggtgaagcc cctgggcgtg gcacccacca acgcccgcga 1440

gcgcgtcgtg gagcgcgaga aggagtagta agggacctga attcggtcac cggatcc 1497

<210> SEQ ID NO 150

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 150

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagatga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gatcaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgaca agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg tactgcaaca tctcggagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaacaac acgcgcccca tcacgatcca 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggca tcgcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagggtcct gaattcggtc 1500

accggatcc 1509

<210> SEQ ID NO 151

<211> LENGTH: 1530

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 151

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggggct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacggc ctccaacgcc accgcgtcca actcctccat 420

catcgagggc atgaagaact gctccttcaa catcacgacg gagctgcgcg acaagcgcga 480

gaagaagaac gccctgttct acaagctgga catcgtgcag ctggacggca actcctcgca 540

gtacaggctg atcaactgca acacctccgt catcacgcag gcgtgcccca aggtgtcctt 600

cgaccccatc cccatccact actgcgcccc cgccggctac gccatcctga agtgcaacaa 660

caagaccttc accggcaccg gcccgtgcaa caacgtgtcc accgtgcagt gcacgcacgg 720

gatcaagccc gtggtgtcca cgcagctgct cctgaacggg tcgctggccg agggcgagat 780

catcatccgg tccgagaaca tcacgaacaa cgggaagacc atcatcgtgc acctgaacga 840

gtccgtgaag atcgagtgca cccgcccgaa caacaagacg cgcacctcca tccggatcgg 900

ccctggccag gccttctacg ccaccggcca ggtgatcggc gacatccgcg aggcgcactg 960

caacatcagc gagtccaagt ggaacgagac cctgcagcgc gtgtccaaga agctgaagga 1020

gtacttcccc caccagaaca tcaccttcca gccgtcgtcc ggcggcgacc tcgagatcac 1080

cacgcactcc ttcaactgcg gtggcgagtt cttctactgc aacacgtcgt cgctgttcaa 1140

ccgcacctac atggccaact ccaccgacat ggccaactcc accgagacca actccacgcg 1200

caccatcacg atccgctgcc gcatcaagca gatcatcaac atgtggcagg aggtgggccg 1260

cgccatgtac gcaccgccca tcgccggcaa catcacctgc atctccaaca tcaccggcct 1320

cctgctgacc cgcgacggcg gcaagaacaa cacggacacg gagaccttca ggccaggcgg 1380

aggcaacatg aaggacaact ggcgctccga gctgtacaag tacaaggtgg tggaggtgaa 1440

gcccctgggc gtggcaccca ccaacgcccg cgagcgcgtc gtggagcgcg agaaggagta 1500

gtaagggtcc cgaattcggt aaccggatcc 1530

<210> SEQ ID NO 152

<211> LENGTH: 1525

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 152

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacgaa cgccaccgcg tccaactcct ccatcatcga 420

gggcatgaag aactgctcct tcaacatcac gacggagctg cgcgacaagc gcgagaagaa 480

gaacgccctg ttctacaagc tggacatcgt gcagctggac ggcaactcct cgcagtacag 540

gctgatcaac tgcaacacct ccgtcatcac gcaggcgtgc cccaaggtgt ccttcgaccc 600

catccccatc cactactgcg cccccgccgg ctacgccatc ctgaagtgca acaacaagac 660

cttcaccggc accggcagct gcaacaacgt gtccaccgtg cagtgcacgc acgggatcaa 720

gcccgtggtg tccacgcagc tgctcctgaa cgggtcgctg gccgagggcg agatcatcat 780

ccggtccgag aacatcacgg acaacgggaa gaccatcatc gtgcacctga acgagtccgt 840

gaagatcgag tgcacccgcc cgaacaacaa gacgcgcacc tccatccgga tcggccctgg 900

ccaggccttc tacgccaccg gccaggtgat cggcgacatc aaggaggcgt actgcaacat 960

ctcggagtcc aagtggaacg agaccctgca gcgcgtgtcc aagaagctga aggagtactt 1020

cccccacaag aacatcacct tccagccgtc gtccggcggc gacctcgaga tcaccacgca 1080

ctccttcaac tgcggtggcg agttcttcta ctgcaacacg tcgtcgctgt tcaaccgcac 1140

ctacatggcc aactccaccg acatggccaa ctccaccgag accaactcca cgcgcaacat 1200

cacgatccac tgccgcatca agcagatcat caacatgtgg caggaggtgg gccgcgccat 1260

gtacgcaccg cccatcgccg gcaacatcac ctgcatctcc aacatcaccg gcctcctgct 1320

gacccgcgac ggcggcaaga acaacacgga cacggagacc ttcaggccag gcggaggcaa 1380

catgaaggac aactggcgct ccgagctgta caagtacaag gtggtggagg tgaagcccct 1440

gggcgtggca cccaccaacg cccgcgagcg cgtcgtggag cgcgagaagg agtagtaaga 1500

ggacccgaat tcggtaaccg gatcc 1525

<210> SEQ ID NO 153

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 153

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacggc caacgccacc gcgtccaact cctccatcat 420

cgagggcatg aagaactgct ccttcaacat cacgacggag ctgcgcgaca agcgcgagaa 480

gaagaacgcc ctgttctaca agctggacat cgtgcagctg gacggcaact cctcgcagta 540

caggctgatc aactgcaaca cctccgtcat cacgcaggcg tgccccaagg tgtccttcga 600

ccccatcccc atccactact gcgcccccgc cggctacgcc atcctgaagt gcaacaacaa 660

gaccttcacc ggcaccggcc cgtgcaacaa cgtgtccacc gtgcagtgca cgcacgggat 720

caagcccgtg gtgtccacgc agctgctcct gaacgggtcg ctggccgagg gcgagatcat 780

catccggtcc gagaacatca cgaacaacgc gaagaccatc atcgtgcacc tgaacgagtc 840

cgtgaagatc gagtgcaccc gcccgaacaa caagacgcgc acctccatcc ggatcggccc 900

tggccaggcc ttctacgcca ccggccaggt gatcggcgac atccgcgagg cgtactgcaa 960

catcagcgag tccaagtgga acgagaccct gcagcgcgtg tccaagaagc tgaaggagta 1020

cttcccccac aagaacatca ccttccagcc gtcgtccggc ggcgacctcg agatcaccac 1080

gcactccttc aactgcggtg gcgagttctt ctactgcaac acgtcgtcgc tgttcaaccg 1140

cacctacatg gccaactcca ccgacatggc caactccacc gagaccaact ccacgcgcat 1200

catcacgatc cactgccgca tcaagcagat catcaacatg tggcaggagg tgggccgcgc 1260

catgtacgca ccgcccatcg ccggcaacat cacctgcatc tccaacatca ccggcctcct 1320

gctgacccgc gacggcggca agaacaaccc ggagaccttc aggccaggcg gaggcaacat 1380

gaaggacaac tggcgctccg agctgtacaa gtacaaggtg gtggaggtga agcccctggg 1440

cgtggcaccc accaacgccc gcgagcgcgt cgtggagcgc gagaaggagt agtaagaggt 1500

cccgaattcg gtaaccggat cc 1522

<210> SEQ ID NO 154

<211> LENGTH: 1533

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 154

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacggc ccggaactgc acgaacgcca ccgcgtccaa 420

ctcctccatc atcgagggca tgaagaactg ctccttcaac atcacgacgg agctgcgcga 480

caagcgcgag aagaagaacg ccctgttcta caagctggac atcgtgcagc tggacggcaa 540

ctcctcgcag tacaggctga tcaactgcaa cacctccgtc atcacgcagg cgtgccccaa 600

ggtgtccttc gaccccatcc ccatccacta ctgcgccccc gccggctacg ccatcctgaa 660

gtgcaacaac aagaccttca ccggcaccgg cccgtgcaac aacgtgtcca ccgtgcagtg 720

cacgcacggg atcaagcccg tggtgtccac gcagctgctc ctgaacgggt cgctggccga 780

gggcgagatc atcatccggt ccgagaacat cacgaacagc gggaagacca tcatcgtgca 840

cctgaacgag tccgtgaaga tcgagtgcac ccgcccgaac aacaagacgc gcacctccat 900

ccggatcggc cctggccagg ccttctacgc caccggccag gtgatcggcg acatccgcga 960

ggcgtactgc aacatctcgg agtccaagtg gaacgagacc ctgcagcgcg tgtccaagaa 1020

gctgaaggag tacttccccc acaagaacat caccttccag ccgtcgtccg gcggcgacct 1080

cgagatcacc acgcactcct tcaactgcgg tggcgagttc ttctactgca acacgtcgtc 1140

gctgttcaac cgcacctaca tggccaactc caccgacatg gccaactcca ccgagaccaa 1200

ctccacgcgc atcatcacga tccactgccg catcaagcag atcatcaaca tgtggcagga 1260

ggtgggccgc gccatgtacg caccgcccat cgccggcaac atcacctgca tctccagcat 1320

caccggcctc ctgctgaccc gcgacggcgg cgagaacaac acggagacct tcaggccagg 1380

cggaggcaac atgaaggaca actggcgctc cgagctgtac aagtacaagg tggtggaggt 1440

gaagcccctg ggcgtggcac ccaccaacgc ccgcgagcgc gtcgtggagc gcgagaagga 1500

gtagtaaggg acctgaattc ggtaaccgga tcc 1533

<210> SEQ ID NO 155

<211> LENGTH: 1542

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 155

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacgac caacgccacc gcgtccaact cctccatcat 420

cgagggcatg aagaactgct ccttcaacat cacgacggag ctgcgcgaca agcgcgagaa 480

gaagaacgcc ctgttctaca agctggacat cgtgcagctg gacggcaact cctcgcagta 540

caggctgatc aactgcaaca cctccgtcat cacgcaggcg tgccccaagg tgtccttcga 600

ccccatcccc atccactact gcgcccccgc cggctacgcc atcctgaagt gcaacaacaa 660

gaccttcacc ggcaccggcc cgtgcaacaa cgtgtccacc gtgcagtgca cgcacgggat 720

caagcccgtg gtgtccacgc agctgctcct gaacgggtcg ctggccgagg gcgagatcat 780

catccggtcc gagaacatca cgaacaacgc gaagaccatc atcgtgcacc tgaacgagtc 840

cgtgaagatc gagtgcaccc gcccgaacaa caagacgcgc acctccatcc ggatcggccc 900

tggccaggcc ttctacgcca ccggccaggt gatcggcgac atccgcgagg cgtactgcaa 960

catcagcgag tccaagtgga acgagaccct gcagcgcgtg tccaagaagc tgaaggagta 1020

cttcccccac aagaacatca ccttccagcc gtcgtccggc ggcgacctcg agatcaccac 1080

gcactccttc aactgcggtg gcgagttctt ctactgcaac acgtcgtcgc tgttcaaccg 1140

cacctacatg gccaactcca ccgacatggc caactccacc gagaccaact ccacgcgcat 1200

catcacgatc cactgccgca tcaagcagat catcaacatg tggcaggagg tgggccgcgc 1260

catgtacgca ccgcccatcg ccggcaacat cacctgcatc tccaacatca ccggcctcct 1320

gctgacccgc gacggcggca agaacacgag ggacggaggc aagaacaaca cggagacctt 1380

caggccaggc ggaggcaaca tgaaggacaa ctggcgctcc gagctgtaca agtacaaggt 1440

ggtggaggtg aagcccctgg gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg 1500

cgagaaggag tagtaagggt cctgaattcg gtaaccggat cc 1542

<210> SEQ ID NO 156

<211> LENGTH: 1521

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 156

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacgac gaacgccacc gcgtccaact cgtccatcat 420

cgaggagatg aagaactgct ccttcaacat cacgacggag ctgcgcgaca agcgcgagaa 480

gaagaacgcc ctgttctaca agctggacat cgtgcagctg gacggcaact cctcgcagta 540

caggctgatc aactgcaaca cctccgtcat cacgcaggcg tgccccaagg tgtccttcga 600

ccccatcccc atccactact gcgcccccgc cggctacgcc atcctgaagt gcaacaacaa 660

gaccttcacc ggcaccggcc cgtgcaacaa cgtgtccacc gtgcagtgca cgcacgggat 720

caagcccgtg gtgtccacgc agctgctcct gaacgggtcg ctggccgagg gcgagatcat 780

catccggtcc gagaacatca cgaacacggc gaagaccatc atcgtgcacc tgaacgagtc 840

cgtgaagatc gagtgcaccc gcccgaacaa caagacgcgc acctccatcc ggatcggccc 900

tggccaggcc ttctacgcca ccggccaggt gatcggcgac atccgcgagg cgtactgcaa 960

catctcggag tccaagtgga acgagaccct gcagcgcgtg tccaagaagc tgaaggagta 1020

cttcccccac aagaacatca ccttccagcc gtcgtccggc ggcgacctcg agatcaccac 1080

gcactccttc aactgcggtg gcgagttctt ctactgcaac acgtcgtcgc tgttcaaccg 1140

cacctacatg gccaactcca ccgacatggc caactccacc gagaccaact ccacgcgcac 1200

catcacgatc cggtgccgca tcaagcagat catcaacatg tggcaggagg tgggccgcgc 1260

catgtacgca ccgcccatcg ccggcaacat cacctgcatc tccaacatca ccggcctcct 1320

gctgacccgc gacggcggcg agaacaacac ggagaccttc aggccaggcg gaggcaacat 1380

gaaggacaac tggcgctccg agctgtacaa gtacaaggtg gtggaggtga agcccctggg 1440

cgtggcaccc accaacgccc gcgagcgcgt cgtggagcgc gagaaggagt agtaagggtc 1500

ccgaattcgg ttaccggatc c 1521

<210> SEQ ID NO 157

<211> LENGTH: 1531

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 157

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacggc ctccaacgcc accgcgtcca actcctccat 420

catcgagggc atgaagaact gctccttcaa catcacgacg gagctgcgcg acaagcgcga 480

gaagaagaac gccctgttct acaagctgga catcgtgcag ctggacggca actcctcgca 540

gtacaggctg atcaactgca acacctccgt catcacgcag gcgtgcccca aggtgtcctt 600

cgaccccatc cccatccact actgcgcccc cgccggctac gccatcctga agtgcaacaa 660

caagaccttc accggcaccg gcccgtgcaa caacgtgtcc accgtgcagt gcacgcacgg 720

gatcaagccc gtggtgtcca cgcagctgct cctgaacggg tcgctggccg agggcgagat 780

catcatccgg tccgagaaca tcacgaacaa cgggaagacc atcatcgtgc acctgaacga 840

gtccgtgaag atcgagtgca cccgcccgag caacaagacg cgcacctcca tccggatcgg 900

ccctggccag gccttctacg ccaccggcca ggtgatcggc gacatccgcg aggcgcactg 960

caacatctcg gagtccaagt ggaacgagac cctgcagcgc gtgtccaaga agctgaagga 1020

gtacttcccc cacaagaaca tcaccttcca gccgtcgtcc ggcggcgacc tcgagatcac 1080

cacgcactcc ttcaactgcg gtggcgagtt cttctactgc aacacgtcgt cgctgttcaa 1140

ccgcacctac atggccaact ccaccgacat ggccaactcc accgagacca actccacgcg 1200

caccatcacg ctccactgcc gcatcaagca gatcatcaac atgtggcagg aggtgggccg 1260

cgccatgtac gcaccgccca tcgccggcaa catcacctgc atctccaaca tcaccggcct 1320

cctgctgacc cgcgacggcg gcaagaacaa caccgacacg gagaccttca ggccaggcgg 1380

aggcaacatg aaggacaact ggcgctccga gctgtacaag tacaaggtgg tggaggtgaa 1440

gcccctgggc gtggcaccca ccaacgcccg cgagcgcgtc gtggagcgcg agaaggagta 1500

gtaagaggac ccgaattcgg ttaccggatc c 1531

<210> SEQ ID NO 158

<211> LENGTH: 1528

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 158

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacgac caacgccacc gcgtccaact cctccatcat 420

cgagggcatg aagaactgct ccttcaacat cacgacggag ctgcgcgaca agcgcgagaa 480

gaagaacgcc ctgttctaca agctggacat cgtgcagctg gacggcaact cctcgcagta 540

caggctgatc aactgcaaca cctccgtcat cacgcaggcg tgccccaagg tgtccttcga 600

ccccatcccc atccactact gcgcccccgc cggctacgcc atcctgaagt gcaacaacaa 660

gaccttcacc ggcaccggcc cgtgcaacaa cgtgtccacc gtgcagtgca cgcacgggat 720

caagcccgtg gtgtccacgc agctgctcct gaacgggtcg ctggccgagg gcgagatcat 780

catccggtcc gagaacatca cgaacaacgc gaagaccatc atcgtgcacc tgaacgagtc 840

cgtgaagatc gagtgcaccc gcccgaacaa caagacgcgc acctccatcc ggatcggccc 900

tggccaggcc ttctacgcca ccggccaggt gatcggcgac atccgcgagg cgcactgcaa 960

catcagcgag tccaagtgga acgagaccct gcagcgcgtg tccaagaagc tgaaggagta 1020

cttcccccac aagaacatca ccttccagcc gtcgtccggc ggcgacctcg agatcaccac 1080

gcactccttc aactgcggtg gcgagttctt ctactgcaac acgtcgtcgc tgttcaaccg 1140

cacctacatg gccaactcca ccgacatggc caactccacc gagaccaact ccacgcgcac 1200

catcacgatc cgctgccgca tcaagcagat catcaacatg tggcaggagg tgggccgcgc 1260

catgtacgca ccgcccatcg ccggcaacat cacctgcatc tccaacatca ccggcctcct 1320

gctgacccgc gacggcggca agaacaacac cgacacggag accttcaggc caggcggagg 1380

caacatgaag gacaactggc gctccgagct gtacaagtac aaggtggtgg aggtgaagcc 1440

cctgggcgtg gcacccacca acgcccgcga gcgcgtcgtg gagcgcgaga aggagtagta 1500

agaggtcccg aattcggtta ccggatcc 1528

<210> SEQ ID NO 159

<211> LENGTH: 1530

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 159

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacggc cagcaacgcc accgcgtcca actcctccat 420

catcgagggc atgaagaact gctccttcaa catcacgacg gagctgcgcg acaagcgcga 480

gaagaagaac gccctgttct acaagctgga catcgtgcag ctggacggca actcctcgca 540

gtacaggctg atcaactgca acacctccgt catcacgcag gcgtgcccca aggtgtcctt 600

cgaccccatc cccatccact actgcgcccc cgccggctac gccatcctga agtgcaacaa 660

caagaccttc accggcaccg gcccgtgcaa caacgtgtcc accgtgcagt gcacgcacgg 720

gatcaagccc gtggtgtcca cgcagctgct cctgaacggg tcgctggccg agggcgagat 780

catcatccgg tccgagaaca tcacgaacaa cgtgaagacc atcatcgtgc acctgaacga 840

gtccgtgaag atcgagtgca cccgcccgaa caacaagacg cgcacctcca tccggatcgg 900

ccctggccag gccttctacg ccaccggcca ggtgatcggc aacatccgcg aggcgtactg 960

caacatctcg gagtccaagt ggaacgagac cctgcagcgc gtgtccaaga agctgaagga 1020

gtacttcccc cacaagaaca tcaccttcca gccgtcgtcc ggcggcgacc tcgagatcac 1080

cacgcactcc ttcaactgcg gtggcgagtt cttctactgc aacacgtcgt cgctgttcaa 1140

ccgcacctac atggccaact ccaccgacat ggccaactcc accgagacca actccacgcg 1200

catcatcacg atccactgcc gcatcaagca gatcatcaac atgtggcagg aggtgggccg 1260

cgccatgtac gcaccgccca tcgccggcaa catcacctgc atctccaaca tcaccggcct 1320

cctgctgacc cgcgacggcg gcaagaacaa caccgacacg gagaccttca ggccaggcgg 1380

aggcaacatg aaggacaact ggcgctccga gctgtacaag tacaaggtgg tggaggtgaa 1440

gcccctgggc gtggcaccca ccaacgcccg cgagcgcgtc gtggagcgcg agaaggagta 1500

gtaagggacc tgaattcggt taccggatcc 1530

<210> SEQ ID NO 160

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 160

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagatga ccccgctgtg 360

cgtgaccctg aactgcacca acgccaccgc gatcaactcc tccatcatcg agggcatgaa 420

gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga agaacgccct 480

gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa 540

ctgcaacacc tccgtcatca cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat 600

ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga ccttcaccgg 660

caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca agcccgtggt 720

gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca tccggtccga 780

gaacatcacg aacaacgaca agaccatcat cgtgcacctg aacgagtccg tgaagatcga 840

gtgcacccgc ccgaacaaca agacgcgcac ctccatccgg atcggccctg gccaggcctt 900

ctacgccacc ggccaggtga tcggcgacat ccgcgaggcg cactgcaaca tctcggagtc 960

caagtggaac gagaccctgc agcgcgtgtc caagaagctg aaggagtact tcccccacaa 1020

gaacatcacc ttccagccgt cgtccggcgg cgacctcgag atcaccacgc actccttcaa 1080

ctgcggtggc gagttcttct actgcaacac gtcgtcgctg ttcaaccgca cctacatggc 1140

caactccacc gacatggcca actccaccga gaccaactcc acgcgcacca tcacgatccg 1200

ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc 1260

gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc tgacccgcga 1320

cggcggcaag aacaacacgg agaccttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagggtcct gaattcggtt 1500

accggatcc 1509

<210> SEQ ID NO 161

<211> LENGTH: 1527

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 161

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacggc caacgccacc gcgtccaact cctccatcat 420

cgagggcatg aagaactgct ccttcaacat cacgacggag ctgcgcgaca agcgcgagaa 480

gaagaacgcc ctgttctaca agctggacat cgtgcagctg gacggcaact cctcgcagta 540

caggctgatc aactgcaaca cctccgtcat cacgcaggcg tgccccaagg tgtccttcga 600

ccccatcccc atccactact gcgcccccgc cggctacgcc atcctgaagt gcaacaacaa 660

gaccttcaac ggcaccggcc cgtgcaacaa cgtgtccacc gtgcagtgca cgcacgggat 720

caagcccgtg gtgtccacgc agctgctcct gaacgggtcg ctggccgagg gcgagatcat 780

catccggtcc gagaacatca cgaacaacgt gaagaccatc atcgtgcacc tgaacgagtc 840

cgtgaagatc gagtgcaccc gcccgaacaa caagacgcgc acctccatcc ggatcggccc 900

tggccaggcc ttctacgcca ccggccaggt gatcggcgac atccgcgagg cgtactgcaa 960

catctcggag tccaagtgga acgagaccct gcagcgcgtg tccaagaagc tgaaggagta 1020

cttcccccac aagaacatca ccttccagcc gtcgtccggc ggcgacctcg agatcaccac 1080

gcactccttc aactgcggtg gcgagttctt ctactgcaac acgtcgtcgc tgttcaaccg 1140

cacctacatg gccaactcca ccgacatggc caactccacc gagaccaact ccacgcgcac 1200

catcaagatc cactgccgca tcaagcagat catcaacatg tggcaggagg tgggccgcgc 1260

catgtacgca ccgcccatcg ccggcaacat cacctgcatc tccaacatca ccggcctcct 1320

gctgacccgc gacggcggca agaacaacac cgacacggag accttcaggc caggcggagg 1380

caacatgaag gacaactggc gctccgagct gtacaagtac aaggtggtgg aggtgaagcc 1440

cctgggcgtg gcacccacca acgcccgcga gcgcgtcgtg gagcgcgaga aggagtagta 1500

agaattcggt gaccgggacc cggatcc 1527

<210> SEQ ID NO 162

<211> LENGTH: 1509

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 162

gtgtcgacaa gaagccacca tgcgcgtgat gggcatccag cgcaactacc cgcagtggtg 60

gatctggtcg atgctgggct tctggatgct catgatctgc aacggcgtgc cggtgtggaa 120

ggaggccaag acgaccctgt tctgcgcgtc ggacgccaag gcctacgaga aggaggtgca 180

caacgtgtgg gcgacccacg cctgcgtgcc cacggacccc aacccgcagg agatggtgct 240

gaagaacgtg accgagaact tcaacatgtg gaagaacgac atggtggacc agatgcacga 300

ggacgtgatc tccctgtggg accagtccct gaagccctgc gtgaagctga ccccgctgtg 360

cgtgaccctg aactgcacca acgcgacgaa cgccaccgcg tccaactcct ccatcctcga 420

gggcatgaag aactgctcct tcaacatcac gacggagctg cgcgacaagc gcgagaagaa 480

gaacgccctg ttctacaagc tggacatcgt gcagctggac ggcaactcct cgcagtacag 540

gctgatcaac tgcaacacct ccgtcatcac gcaggcgtgc cccaaggtgt ccttcgaccc 600

catccccatc cactactgcg cccccgccgg ctacgccatc ctgaagtgca acaacaagac 660

cttcaacggc accggcccgt gcaacaacgt gtccaccgtg cagtgcacgc acgggatcaa 720

gcccgtggtg tccacgcagc tgctcctgaa cgggtcgctg gccgagggcg agatcatcat 780

ccggtccgag aacatcacgg acaacgggaa gaccatcatc gtgcacctga acgagtccgt 840

gaagatcgag tgcacccgcc cgagcaacaa cacgcgcacc tccatccgga tcggccctgg 900

ccaggccttc tacgccaccg gccaggtgat cggcgacatc cgcgaggcgc actgcaacat 960

ctcggagtcc aagtggaacg agaccctgca gcgcgtgtcc aagaagctga aggagtactt 1020

cccccacaag aacatcacct tccagccgtc gtccggcggc gacctcgaga tcaccacgca 1080

ctccttcaac tgcggtggcg agttcttcta ctgcaacacg tcgtcgctgt tcaaccgcac 1140

ctacatggcc aactccaccg agaccaactc cacgcgcacc atcacgctcc actgccgcat 1200

caagcagatc atcaacatgt ggcaggaggt gggccgcgcc atgtacgcac cgcccatcgc 1260

cggcaacatc acctgcatct ccaacatcac cggcctcctg ctgacccgcg acggcggcaa 1320

gaacaacacg gagaccttcg agacgttcag gccaggcgga ggcaacatga aggacaactg 1380

gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg tggcacccac 1440

caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagaattcg gtcaccggga 1500

cccggatcc 1509

<210> SEQ ID NO 163

<211> LENGTH: 1507

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 163

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccaac gcgacgaacg ccaccgcgtc caactcctcc atcctcgagg 420

gcatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctggacgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtccgagaa catcacggac aacgggaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg tcgaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcgacatccg cgaggcgcac tgcaacatct 960

cggagtccaa gtggaacgag accctgcagc gcgtgtccaa gaagctgaag gagtacttcc 1020

cccacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtcgctgttc aaccgcacct 1140

acatggccaa ctccaccgag accaactcca cgcgcaccat cacgatccgc tgccgcatca 1200

agcagatcat caacatgtgg caggaggtgg gccgcgccat gtacgcaccg cccatcgccg 1260

gcaacatcac ctgcatctcc aacatcaccg gcctcctgct gacccgcgac ggcggcgaga 1320

acaacacgga gaccttcgag acgttcaggc caggcggagg caacatgaag gacaactggc 1380

gctccgagct gtacaagtac aaggtggtgg aggtgaagcc cctgggcgtg gcacccacca 1440

acgcccgcga gcgcgcggtg gagcgcgaga aggagtagta agaattcggt aaccgggacc 1500

cggatcc 1507

<210> SEQ ID NO 164

<211> LENGTH: 1555

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 164

gtcgacaaga agccaccatg cgcgtgatgg gccgccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccgac gccaccgcgt ccaacgccac ggcgtcgaac tcgtctatca 420

tcgaggggat gaactcctcc atcatcgagg gcatgaagaa ctgctccttc aacatcacga 480

cggagctgcg cgacaagcgc gagaagaaga acgccctgtt ctacaagctg gacatcgtgc 540

agctggacgg caactcctcg cagtacaggc tgatcaactg caacacctcc gtcatcacgc 600

aggcgtgccc caaggtgtcc ttcgacccca tccccatcca ctactgcgcc cccgccggct 660

acgccatcct gaagtgcaac aacaagacct tcaacggcac cggcccgtgc aacaacgtgt 720

ccaccgtgca gtgcacgcac gggatcaagc ccgtggtgtc cacgcagctg ctcctgaacg 780

ggtcgctggc cgagggcgag atcatcatcc ggtccgagaa catcacggac aacgggaaga 840

ccatcatcgt gcacctgaac gagtccgtga agatcgagtg cacccgcccg tcgaacaaca 900

cgcgcacctc catccggatc ggccctggcc aggccttcta cgccaccggc caggtgatcg 960

gcgacatccg cgaggcgcac tgcaacatct cggagtccaa gtggaacgag accctgcagc 1020

gcgtgtccga gaagctgaag gagtacttcc cccacaagaa catcaccttc cagccgtcgt 1080

ccggcggcga cctcgagatc accacgcact ccttcaactg cggtggcgag ttcttctact 1140

gcaacacgtc gtcgctgttc aaccgcacct acatggccac gagcaccgac atggccaact 1200

ccaccgagac caactccacg cgcatcatca cgatccggtg ccgcatcaag cagatcatca 1260

acatgtggca ggaggtgggc cgcgccatgt acgcaccgcc catcgccggc aacatcacct 1320

gcatctccaa catcaccggc ctcctgctga cccgcgacgg cggcaagaac aacacggaga 1380

ccttcgagac gttcaggcca ggcggaggca acatgaagga caactggcgc tccgagctgt 1440

acaagtacaa ggtggtggag gtgaagcccc tgggcgtggc acccaccaac gcccgcgagc 1500

gcgtcgtgga gcgcgagaag gagtagtaag aattcggtta ccgggacccg gatcc 1555

<210> SEQ ID NO 165

<211> LENGTH: 1546

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 165

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccaac gcgaacgcca ccgcgtccaa ctcctctatc atcgagggga 420

tgaactcctc catcatcgag ggcatgaaga actgctcctt caacatcacg acggagctgc 480

gcgacaagcg cgagaagaag aacgccctgt tctacaagct ggacatcgtg cagctggacg 540

gcaactcctc gcagtacagg ctgatcaact gcaacacctc cgtcatcacg caggcgtgcc 600

ccaaggtgtc cttcgacccc atccccatcc actactgcgc ccccgccggc tacgccatcc 660

tgaagtgcaa caacaagacc ttcaacggca ccggcccgtg caacaacgtg tccaccgtgc 720

agtgcacgca cgggatcaag cccgtggtgt ccacgcagct gctcctgaac gggtcgctgg 780

ccgagggcga gatcatcatc cggtccgaga acatcacgga caacgggaag accatcatcg 840

tgcacctgaa cgagtccgtg aagatcgagt gcacccgccc gagcaacaac acgcgcacct 900

ccatccggat cggccctggc caggccttct acgccaccgg ccaggtgatc ggcgacatcc 960

gcgaggcgca ctgcaacatc tcggagtcca agtggaacga gaccctgcag cgcgtgtccg 1020

agaagctgaa ggagtacttc ccccacaaga acatcacctt ccagccgtcg tccggcggcg 1080

acctcgagat caccacgcac tccttcaact gcggtggcga gttcttctac tgcaacacgt 1140

cgtcgctgtt caaccgcacc tacatggcca cgtccaccga catggccaac tccaccgaga 1200

ccaactccac gcgcatcatc acgatccggt gccgcatcaa gcagatcatc aacatgtggc 1260

aggaggtggg ccgcgccatg tacgcaccgc ccatcgccgg caacatcacc tgcatctcca 1320

acatcaccgg cctcctgctg acccgcgacg gcggcaagaa caacacggag accttcgaga 1380

cgttcaggcc aggcggaggc aacatgaagg acaactggcg ctccgagctg tacaagtaca 1440

aggtggtgga ggtgaagccc ctgggcgtgg cacccaccaa cgcccgcgag cgcgtcgtgg 1500

agcgcgagaa ggagtagtaa gaattcggtg accgggtccc ggatcc 1546

<210> SEQ ID NO 166

<211> LENGTH: 1546

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 166

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccgac gccaccgcgt ccaacgcaac cgcgagcaac gccacggcgt 420

cgaactcctc catcatcgag ggcatgaaga actgctcctt caacatcacg acggagctgc 480

gcgacaagcg cgagaagaag aacgccctgt tctacaagct ggacatcgtg cagctggacg 540

gcaactcctc gcagtacagg ctgatcaact gcaacacctc cgtcatcacg caggcgtgcc 600

ccaaggtgtc cttcgacccc atccccatcc actactgcgc ccccgccggc tacgccatcc 660

tgaagtgcaa caacaagacc ttcaacggca ccggcccgtg caacaacgtg tccaccgtgc 720

agtgcacgca cgggatcaag cccgtggtgt ccacgcagct gctcctgaac gggtcgctgg 780

ccgagggcga gatcatcatc cggtccgaga acatcacgga caacgggaag accatcatcg 840

tgcacctgaa cgagtccgtg aagatcgagt gcacccgccc gagcaacaac acgcgcacct 900

ccatccggat cggccctggc caggccttct acgccaccgg ccaggtgatc ggcgacatcc 960

gcgaggcgca ctgcaacatc tcggagaaca agtggaacga gaccctgcag cgcgtgtcca 1020

agaagctgaa ggagtacttc ccccacaaga acatcacctt ccagccgtcg tccggcggcg 1080

acctcgagat caccacgcac tccttcaact gcggtggcga gttcttctac tgcaacacgt 1140

cgtcgctgtt caaccgcacc tacatggcca actccaccga catggccaac tccaccgaga 1200

ccaactccac gcgcaccatc acgatccgct gccgcatcaa gcagatcatc aacatgtggc 1260

aggaggtggg ccgcgccatg tacgcaccgc ccatcgccgg caacatcacc tgcatctcca 1320

acatcaccgg cctcctgctg acccgcgacg gcggcaagaa caacacggag accttcgaga 1380

cgttcaggcc aggcggaggc aacatgaagg acaactggcg ctccgagctg tacaagtaca 1440

aggtggtgga ggtgaagccc ctgggcgtgg cacccaccaa cgcccgcgag cgcgtcgtgg 1500

agcgcgagaa ggagtagtaa gaattcggtg accaggaccc ggatcc 1546

<210> SEQ ID NO 167

<211> LENGTH: 1513

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 167

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccgac gccaccgcgt ccaacgcaac cgcgatcaac tcctccatca 420

tcgagggcat gaagaactgc tccttcaaca tcacgacgga gctgcgcgac aagcgcgaga 480

agaagaacgc cctgttctac aagctggaca tcgtgcagct ggacggcaac tcctcgcagt 540

acaggctgat caactgcaac acctccgtca tcacgcaggc gtgccccaag gtgtccttcg 600

accccatccc catccactac tgcgcccccg ccggctacgc catcctgaag tgcaacaaca 660

agaccttcaa cggcaccggc ccgtgcaaca acgtgtccac cgtgcagtgc acgcacggga 720

tcaagcccgt ggtgtccacg cagctgctcc tgaacgggtc gctggccgag ggcgagatca 780

tcatccggtc cgagaacatc acgaacaacg cgaagaccat catcgtgcac ctgaacgagt 840

ccgtgaagat cgagtgcacc cgcccgtcga acaacacgcg cacctccatc cggatcggcc 900

ctggccaggc cttctacgcc accggccagg tgatcggcga catccgcgag gcgcactgca 960

acatctcgga gtccaagtgg aacgagaccc tgcagcgcgt gtccaagaag ctgaaggagt 1020

acttccccca caagaacatc accttccagc cgtcgtccgg cggcgacctc gagatcacca 1080

cgcactcctt caactgcggt ggcgagttct tctactgcaa cacgtcgtcg ctgttcaacc 1140

gcacctacat ggccaactcc accgagacca actccacgcg catcatcacg atccgctgcc 1200

gcatcaagca gatcatcaac atgtggcagg aggtgggccg cgccatgtac gcaccgccca 1260

tcgccggcaa catcacctgc atctccaaca tcaccggcct cctgctgacc cgcgacggcg 1320

gcaagaacaa cacggagacc ttcgagacgt tcaggccaga gggaggcaac atgaaggaca 1380

actggcgctc cgagctgtac aagtacaagg tggtggaggt gaagcccctg ggcgtggcac 1440

ccaccaacgc ccgcgagcgc gtcgtggagc gcgagaagga gtagtaagaa ttcggtgacc 1500

aggtcccgga tcc 1513

<210> SEQ ID NO 168

<211> LENGTH: 1519

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 168

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccgac gccaccgcgt ccaacgcaac cgcgagcaac gccacggcgt 420

cgaactcctc catcatcgag ggcatgaaga actgctcctt caacatcacg acggagctgc 480

gcgacaagcg cgagaagaag aacgccctgt tctacaagct ggacatcgtg cagctggacg 540

gcaactcctc gcagtacagg ctgatcaact gcaacacctc cgtcatcacg caggcgtgcc 600

ccaaggtgtc cttcgacccc atccccatcc actactgcgc ccccgccggc tacgccatcc 660

tgaagtgcaa caacaagacc ttcaacggca ccggcccgtg caacaacgtg tccaccgtgc 720

agtgcacgca cgggatcaag cccgtggtgt ccacgcagct gctcctgaac gggtcgctgg 780

ccgagggcga gatcatcatc cggtccgaga acatcacgga caacgggaag accatcatcg 840

tgcacctgaa cgagtccgtg aagatcgagt gcacccgccc gtcgaacaac acgcgcacct 900

ccatccggat cggccctggc caggccttct acgccaccgg ccaggtgatc ggcgacatcc 960

gcgaggcgca ctgcaacatc tcggagtcca agtggaacga gaccctgcag cgcgtgtcca 1020

agaagctgaa ggagtacttc ccccacaaga acatcacctt ccagccgtcg tccggcggcg 1080

acctcgagat caccacgcac tccttcaact gcggtggcga gttcttctac tgcaacacgt 1140

cgtcgctgtt caaccgcacc tacatggcca actccaccga gaccaactcc acgcgcatca 1200

tcacgatccg ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca 1260

tgtacgcacc gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc 1320

tgacccgcga cggcggcaac aacaacacgg agaccttcag gccaggcgga ggcaacatga 1380

aggacaactg gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg 1440

tggcacccac caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagaattcg 1500

gtgaccggga cctggatcc 1519

<210> SEQ ID NO 169

<211> LENGTH: 1525

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 169

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaggctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg caaccgcgtc caacaactcc atcctcgagg 420

gcatgaagaa ctgctccttc aacatcgcga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctggacgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcaccgac aacgggaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg tcgaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

cggagtccaa gtggaacgag accctgcagc gcgtgtccaa gaagctgaag gagtacttcc 1020

ccgacaagaa catcacgttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcagctg cggtggcgag ttcttctact gcaacacgtc gtcgctgttc aaccgcacct 1140

acatggccac gaacaccgac atggccaact ccaccgagac caactccacg cgcatcatca 1200

cgatccgctg ccgcatccgg cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcgagaac aacacggaga ccttcgagac gttcaggcca ggcggaggca 1380

acatgaagga caactggcgc tccgagctgt acaagtacaa ggtggtggag gtgaagcccc 1440

tgggcgtggc acccaccaac gcccgcgagc gcgtcgtgga gcgcgagaag gagtagtaag 1500

aattcggtga ccgggtcctg gatcc 1525

<210> SEQ ID NO 170

<211> LENGTH: 1546

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 170

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctg tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggcggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccgac gccaccgcgt ccaacgcaac cgcgagcaac gccacggcgt 420

cgaactcgtc catcaacagc tccatcatcg aggagatgaa gaactgctcc ttcaacatca 480

cgacggagct gcgcgacaag cgcgagaaga agaacgccct gttctacaag ctggacatcg 540

tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa ctgcaacacc tccgcgatca 600

cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat ccactactgc gcccccgccg 660

gctacgccat cctgaagtgc aacaacaaga ccttcaacgg caccggcccg tgcaacaacg 720

tgtccaccgt gcagtgcacg cacgggatca agcccgtggt gtccacgcag ctgctcctga 780

acgggtcgct ggccgagggc gagatcatca tccggtccga gaacatcacg gacaacggga 840

agaccatcat cgtgcacctg aacgagtccg tgaagatcga gtgcacccgc ccgagcaaca 900

acacgcgcac ctccatccgg atcggccctg gccaggcctt ctacgccacc ggccaggtga 960

tcggcgacat ccgcgaggcg cactgcaaca tctcggagtc caagtggaac gagaccctgc 1020

agcgcgtgtc caagaagctg aaggagtact tcccccacaa gaacatcacc ttccagccgt 1080

cgtccggcgg cgacctcgag gtcacgacgc actccttcaa ctgcggtggc gagttcttct 1140

actgcaacac gtcgtcgctg ttcaaccgca ccgacatggc caactccacc gagaccaact 1200

ccacgcgcat catcaccatc cgctgccgca tcaagcagat cgtcaacatg tggcaggagg 1260

tgggccgcgc catgtacgca ccgcccatcg ccggcaacat cacctgcatc tccaacatca 1320

ccggcctcct gctgacccgc gacggcggcg agaacaacgg cgggaagaac aacacggaga 1380

ccttcaggcc aggcggaggc aacatgaagg acaactggcg ctccgagctg tacaagtaca 1440

aggtggtgga ggtgaagccc ctgggcgtgg cacccaccaa cgcccgcgag cgcgtcgtgg 1500

agcgcgagaa ggagtagtaa gaattcggtc accgggtccc ggatcc 1546

<210> SEQ ID NO 171

<211> LENGTH: 1546

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 171

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacacg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccaac gtgaacgcca ccgcgtccaa ctcctctatc atcgagggga 420

tgaactcgtc catcctcgag ggcatgaaga actgctcctt caacatcacg acggagctgc 480

gcgacaagcg cgagaagaag aacgccctgt tctacaagct ggacatcgtg cagctggggg 540

gcaactcctc gcagtacagg ctgatcaact gcaacacctc cgtcatcacg caggcgtgcc 600

ccaaggtgtc cttcgacccc atccccatcc actactgcgc ccccgccggc tacgccatcc 660

tgaagtgcaa caacaagacc ttcaacggca ccggcccgtg caacaacgtg tccaccgtgc 720

agtgcacgca cgggatcaag cccgtggtgt ccacgcagct gctcctgaac gggtcgctgg 780

ccgagggcga gatcatcatc cggtcgaaga acatcacgga caacgggaag accatcatcg 840

tgcacctgaa cgagtccgtg aagatcgagt gcacccgccc gtcgaacaac acgcgcacct 900

ccatccggat cggccctggc caggccttct acgccaccgg ccaggtgatc ggcgacatcc 960

gcgaggcgca ctgcaacatc agcgagtcca agtggaacga gaccctgcag cgcgtgtccg 1020

agaagctgaa ggagtacttc cccgacaaga acatcacctt ccagccgtcg tccggcggcg 1080

acctcgagat caccacgcac tccttcaact gcggtggcga gttcttctac tgcaacacgt 1140

cgtcgctgtt caaccgcacc tacatggcca actccaccga catggccaac tccaccgaga 1200

ccaactccac gcgcatcatc acgatccgct gccgcatcaa gcagatcatc aacatgtggc 1260

aggaggtggg ccgcgccatg tacgcaccgc ccatcgccgg caacatcacc tgcatctcca 1320

acatcaccgg cctcctgctg acccgcgacg gcggcgagaa caacacggag accttcgaga 1380

cgttcaggcc aggcggaggc aacatgaagg acaactggcg ctccgagctg tacaagtaca 1440

aggtggtgga ggtgaagccc ctgggcgtgg cacccaccaa cgcccgcgag cgcgtcgtgg 1500

agcgcgagaa ggagtagtaa gaattcggtc accaggaccc ggatcc 1546

<210> SEQ ID NO 172

<211> LENGTH: 1558

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 172

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctg tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccgac gccaccgcgt ccaacgcaac cgcgagcaac gccacggcgt 420

cgaacgcgac cgcgtcgaac tcctccatca tcatcgaggg catgaagaac tgctccttca 480

acatcacgac ggagctgcgc gacaagcgcg agaagaagaa cgccctgttc tacaagctgg 540

acatcgtgca gctggacggc aactcctcgc agtacaggct gatcaactgc aacacctccg 600

tcatcacgca ggcgtgcccc aaggtgtcct tcgaccccat ccccatccac tactgcgccc 660

ccgccggcta cgccatcctg aagtgcaaca acaagacctt caacggcacc ggcccgtgca 720

acaacgtgtc caccgtgcag tgcacgcacg ggatcaagcc cgtggtgtcc acgcagctgc 780

tcctgaacgg gtcgctggcc gagggcgaga tcatcatccg gtccaagaac atcacggaca 840

acgggaagac catcatcgtg cacctgaacg agtccgtgaa gatcgagtgc acccgcccga 900

gcaacaacac gcgcacctcc atccggatcg gccctggcca ggccttctac gccaccggcc 960

aggtgatcgg cgacatccgc gaggcgcact gcaacatcag cgagtccaag tggaacgaga 1020

ccctgcagcg cgtgtccaag aagctgaagg agtacttccc ccagaagaac atcaccttcc 1080

agccgtcgtc cggcggcgac ctcgagatca ccacgcactc cttcaactgc ggtggcgagt 1140

tcttctactg caacacgtcg tcgctgttca accgcaccta catggccaac tccaccgaca 1200

tggccaactc caccgagacc aaccgcacca tcacgatccg ctgccgcatc aagcagatca 1260

tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc gcccatcgcc ggcaacatca 1320

cctgcatctc caacatcacc ggcctcctgc tgacccgcga cggcggcaag aacaacacgg 1380

agaccttcga gacgttcagg ccaggcggag gcaacatgaa ggacaactgg cgctccgagc 1440

tgtacaagta caaggtggtg gaggtgaagc ccctgggcgt ggcacccacc aacgcccgcg 1500

agcgcgtcgt ggagcgcgag aaggagtagt aagaattcgg tcaccaggtc ccggatcc 1558

<210> SEQ ID NO 173

<211> LENGTH: 1528

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 173

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcgac gccaccgcgt ccaacgcgac ggcgatcaac atctccatca 420

tcgaggagat gaagaactgc tccttcaaca tcacgacgga gctgcgcgac aagcgcgaga 480

agaagaacgc cctgttctac aagctggaca tcgtgcagct ggacggcaac tcctcgcagc 540

acaggctgat caactgcaac acctccgtca tcacgcaggc gtgccccaag gtgtccttcg 600

accccatccc catccactac tgcgcccccg ccggctacgc catcctgaag tgcaacaaca 660

agaccttcaa cggcaccggc ccgtgcaaca acgtgtccac cgtgcagtgc acgcacggga 720

tcaagcccgt ggtgtccacg cagctgctcc tgaacgggtc gctggccgag ggcgagatca 780

tcatccggtc gaagaacatc acggacaacg ggaagaccat catcgtgcac ctgaacgagt 840

ccgtgaagat cgagtgcacc cgcccgagca acaacacgcg cacctccatc cggatcggcc 900

ctggccaggc cttctacgcc accggccagg tgatcggcaa catccgcgag gcgcactgca 960

acatctccga gtccaagtgg aacgagaccc tgcagcgcgt gtccgagaag ctgaaggagt 1020

acttccccca caagaacatc accttccagc cgtcgtccgg cggcgacctc gagatcacca 1080

cgcactcctt caactgcggt ggcgagttct tctactgcaa cacgtcgtcg ctgttcaacc 1140

gcacctacat ggccacctcc accgacatgg ccaactccac cgagaccaac tccacgcgca 1200

tcatcacgat ccgctgccgc atcaagcaga tcatcaacat gtggcaggag gtgggccgcg 1260

ccatgtacgc accgcccatc gccggcaaca tcacctgcat ctccaacatc accggcctcc 1320

tgctgacccg cgacggcggc aagaacgaca ccgacacgga gaccttcagg ccagagggag 1380

gcaacatgaa ggacaactgg cgctccgagc tgtacaagta caaggtggtg gaggtgaagc 1440

ccctgggcgt ggcacccacc aacgcccgcg agcgcgtcgt ggagcgcgag aaggagtagt 1500

aagaattcgg tcaccgggac ctggatcc 1528

<210> SEQ ID NO 174

<211> LENGTH: 1516

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 174

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgag ctgcacgaac gccaccaacg cgacggcgtc gaactcgtcc atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctggacgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacgggaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcgacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag gagtacttcc 1020

cccacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtcgctgttc aaccgcacct 1140

acatggccac ctccaccgac atggccaact ccaccgagac caactccacg cgcatcatca 1200

cgatccgctg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaagaac gacacggaca ccttcaggcc agagggaggc aacatgaagg 1380

acaactggcg ctccgagctg tacaagtaca aggtggtgga ggtgaagccc ctgggcgtgg 1440

cacccaccaa cgcccgcgag cgcgtcgtgg agcgcgagaa ggagtagtaa gaattcggtc 1500

accgggtcct ggatcc 1516

<210> SEQ ID NO 175

<211> LENGTH: 1525

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 175

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgga ctgcatcaac gccaccaacg cgacggcgtc gaactcctcc atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggggg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacgggaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcgacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccaa gaagctgaag gagtacttcc 1020

ccgacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggtgaa ctccaccgac atggccaact ccaccgagac caactccacg cgcaccatca 1200

cgatccgctg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcgagaac aacaccgaga cgttcgagac cttcaggcca gggggaggca 1380

acatgaagga caactggcgc tccgagctgt acaagtacaa ggtggtggag gtgaagcccc 1440

tgggcgtggc acccaccaac gcccgcgagc gcgtcgtgga gcgcgagaag gagtagtaag 1500

aattcggtaa ccgggtcccg gatcc 1525

<210> SEQ ID NO 176

<211> LENGTH: 1558

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 176

gtcgacaaga agccaccatg cgcgtgatgg gccgccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga cgccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccgac gccaccgcat ccaacgcgac ggcttccaac gccacggcgt 420

cgaacgcgac agcgtcgaac tcgtctatcg aggggatgaa gaactgctcc ttcaacatca 480

cgacggagct gcgcgacaag cgcgagaaga agaacgccct gttctacaag ctggacatcg 540

tgcagctgga cggcaactcc tcgcagtaca ggctgatcaa ctgcaacacc tccgtcatca 600

cgcaggcgtg ccccaaggtg tccttcgacc ccatccccat ccactactgc gcccccgccg 660

gctacgccat cctgaagtgc aacaacaaga ccttcaacgg caccggcccg tgcaacaacg 720

tgtccaccgt gcagtgcacg cacgggatca agcccgtggt gtccacgcag ctgctcctga 780

acgggtcgct ggccgagggc gagatcatca tccggtcgaa gaacatcacg gacaacggga 840

agaccatcat cgtgcacctg aacgagtccg tgaagatcga gtgcacccgc ccgagcaaca 900

acacgcgcac ctccatccgg atcggccctg gccaggcctt ctacgccacc ggccaggtga 960

tcggcgacat ccgcgaggcg cactgcaaca tctccgagtc caagtggaac gagaccctgc 1020

agcgcgtgtc cgagaagctg aaggagtact tccccaacaa gaacatcacc ttccagccgt 1080

cgtccggcgg cgacctcgag atcaccacgc actccttcaa ctgcggtggc gagttcttct 1140

actgcaacac gtcgtcgctg ttcaaccgca cctacatggc caactccacc gacatggcca 1200

actccaccga gaccaactcc acgcgcatca tcacgatccg ctgccgcatc aagcagatca 1260

tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc gcccatcgcc ggcaacatca 1320

cctgcatctc caacatcacc ggcctcctgc tgacccgcga cggcggcaag aacaacaccg 1380

agacgttcga gaccttcagg ccagggggag gcaacatgaa ggacaactgg cgctccgagc 1440

tgtacaagta caaggtggtg gaggtgaagc ccctgggcgt ggcacccacc aacgcccgcg 1500

agcgcgtcgt ggagcgcgag aaggagtagt aagaattcgg taaccaggac ccggatcc 1558

<210> SEQ ID NO 177

<211> LENGTH: 1513

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 177

gtcgacaaga agccaccatg cgcgtgacgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggcggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcgac gccaacgcga ccgcgtccaa cgcgacggca tccaactcgt 420

ccatcatcga ggggatgaag aactgctcct tcaacatcac gacggagctg cgcgacaaga 480

tcgagaagaa gaacgccctg ttctacaagc tggacatcgt gcagctggac ggcaactcct 540

cgcagtacag gctgatcaac tgcaacacct ccgtcatcac gcaggcgtgc cccaaggtgt 600

ccttcgaccc catccccatc cactactgcg cccccgccgg ctacgccatc ctgaagtgca 660

acaacaagac cttcaacggc accggcccgt gcaacaacgt gtccaccgtg cagtgcacgc 720

acgggatcaa gcccgtggtg tccacgcagc tgctcctgaa cgggtcgctg gccgagggcg 780

agatcatcat ccggtcggag aacatcacga acagcgcgaa gaccatcatc gtgcacctga 840

acgagtccgt gaagatcgag tgcacccgcc cgagcaacaa cacgcgcacc tccatccgga 900

tcggccctgg ccaggccttc tacgccaccg gccaggtgat cggcgacatc cgcaaggcgc 960

actgcaacat ctccgagtcc aagtggaacg agaccctgca gcgcgtgtcc aagaagctga 1020

aggagtactt cccccacaag aacatcacct tccagccgtc gtccggcggc gacctcgaga 1080

tcaccacgca ctccttcaac tgcggtggcg agttcttcta ctgcaacacg tcgtcgctgt 1140

tcaaccgcac ctacatggcc aactccaccg agaccaactc cacgcgcacg atcacgctcc 1200

actgccgcat caagcagatc atcaacatgt ggcaggaggt gggccgcgcc atgtacgcac 1260

cgcccatcgc cggcaacatc acctgcatct ccaacatcac cggcctcctg ctgacccgcg 1320

acggcggcaa caacaacacc acggagacct tcaggccagg gggaggcaac atgaaggaca 1380

actggcgctc cgagctgtac aagtacaagg tggtggagat caagcccctg ggcgtggcac 1440

ccaccaacgc ccgcgagcgc gtcgtggagc gcgagaagga gtagtaagaa ttcggtaacc 1500

aggtcccgga tcc 1513

<210> SEQ ID NO 178

<211> LENGTH: 1528

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 178

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcgac gccaccgcgt ccaacgcgac ggcgatcaac atctccatca 420

tcgaggagat gaagaactgc tccttcaaca tcacgacgga gctgcgcgac aagcgcgaga 480

agaagaacgc cctgttctac aagctggaca tcgtgcagct ggacggcaac tcctcgcagc 540

acaggctgat caactgcaac acctccgtca tcacgcaggc gtgccccaag gtgtccttcg 600

accccatccc catccactac tgcgcccccg ccggctacgc catcctgaag tgcaacaaca 660

agaccttcaa cggcaccggc ccgtgcaaca acgtgtccac cgtgcagtgc acgcacggga 720

tcaagcccgt ggtgtccacg cagctgctcc tgaacgggtc gctggccgag ggcgagatca 780

tcatccggtc gaagaacatc acggacaacg ggaagaccat catcgtgcac ctgaacgagt 840

ccgtgaagat cgagtgcacc cgcccgagca acaacacgcg cacctccatc cggatcggcc 900

ctggccaggc cttctacgcc accggccagg tgatcggcaa catccgcgag gcgcactgca 960

acatctccaa gtccaagtgg aacgagaccc tgcagcgcgt gtccgagaag ctgaaggagt 1020

acttccccca caagaacatc accttccagc cgtcgtccgg cggcgacctc gagatcacca 1080

cgcactcctt caactgcggt ggcgagttct tctactgcaa cacgtcgtcg ctgttcaacc 1140

gcacctacat ggccacctcc accgacatgg ccaactccac cgagaccaac tccacgcgca 1200

tcatcacgat ccgctgccgc atcaagcaga tcatcaacat gtggcaggag gtgggccgcg 1260

ccatgtacgc accgcccatc gccggcaaca tcacctgcat ctccaacatc accggcctcc 1320

tgctgacccg cgacggcggc aagaacgaca ccgacacgga gaccttcagg ccagagggag 1380

gcaacatgaa ggacaactgg cgctccgagc tgtacaagta caaggtggtg gaggtgaagc 1440

ccctgggcgt ggcacccacc aacgcccgcg agcgcgtcgt ggagcgcgag aaggagtagt 1500

aagaattcgg taaccgggac ctggatcc 1528

<210> SEQ ID NO 179

<211> LENGTH: 1543

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 179

gtcgacaaga agccaccatg cgcgtgatgg gcatccagaa gaactgcccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgcaa ccgcgtccaa ctcgtccatc atcaagggga 420

tgaactcgtc catgatcgag gagatgaaga actgctcctt caacatcacg acggagctgc 480

gcgacaagcg cgagaagaag aacgccctgt tctacaagct ggacatcgtg cagctggacg 540

gcaactcctc gcagtacagg ctgatcaact gcaacacctc cgtcatcacg caggcgtgcc 600

ccaaggtgtc cttcgacccc atccccatcc actactgcgc ccccgccggc tacgccatcc 660

tgaagtgcaa caacaagacc ttcaacggca ccggcccgtg caacaacgtg tccaccgtgc 720

agtgcacgca cgggatcaag cccgtggtgt ccacgcagct gctcctgaac gggtcgctgg 780

ccgagggcga gatcatcatc cggtcgaaga acatcacgga caacgggaag accatcatcg 840

tgcacctgaa cgagtccgtg aagatcgagt gcacccgccc gagcaacaac acgcgcacct 900

ccatccggat cggccctggc caggccttct acgccaccgg ccaggtgatc ggcgacatcc 960

gcgaggcgca ctgcaacatc tccgagtcca agtggaacga gaccctgcag cgcgtgtcca 1020

agaagctgaa ggagtacttc ccccagaagg acatcacctt ccagccgtcg tccggcggcg 1080

acctcgagat caccacgcac tccttcaact gcggtggcga gttcttctac tgcaacacgt 1140

cgtcgctgtt caaccgcacc tacatggcca cctccaccga catggccaac tccaccgaga 1200

ccaactccac gcgcatcatc acgatccgct gccgcatcaa gcagatcatc aacatgtggc 1260

aggaggtggg ccgcgccatg tacgcaccgc ccatcgccgg caacatcacc tgcatctcca 1320

acatcaccgg cctcctgctg acccgcgacg gcggcgagaa cgacaccgac acggagacct 1380

tcaggccaga gggaggcaac atgaaggaca actggcgctc cgagctgtac aagtacaagg 1440

tggtggaggt gaagcccctg ggcgtggcac ccaccaacgc ccgcgagcgc gtcgtggagc 1500

gcgagaagga gtagtaagaa ttcggtaacc gggtcctgga tcc 1543

<210> SEQ ID NO 180

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 180

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg ctcgtacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gcgcctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggcgtc gaactcctcc atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctggacgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacgggaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcgacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag gagtacttcc 1020

ccgacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gaacctgttc aaccgcacct 1140

acatggtgaa ctccaccgac atggccaact ccaccgagac caactccacg cgcaccatca 1200

cgatcagctg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaagaac gacaccgaca cggagacctt caggccagag ggaggcaaca 1380

tgaaggacaa ctggcgctcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaagaat 1500

tcggttaccg ggtcccggat cc 1522

<210> SEQ ID NO 181

<211> LENGTH: 1519

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 181

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggcgtc gaactcctcc atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctggacgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtccaagaa catcacggac aacgggaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag gagtacttcc 1020

cccagaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgac ctccaccgac atggccaact ccaccgagac caactccacg cgcatcatca 1200

cgatccgctg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacgac accgacacgg agaccttcag gccagaggga ggcaacatga 1380

aggacaactg gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg 1440

tggcacccac caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagaattcg 1500

gttaccagga cccggatcc 1519

<210> SEQ ID NO 182

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 182

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaccaacg cgacggcgtc gaactcctcc atcctcggcg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctggacgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gcgatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacgggaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcgacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag gagtacttcc 1020

ccgacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgaa ctccaccgac atggccaact ccaccgagac caactccacg cgcatcatca 1200

cgatccgctg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaagaac gacaccgaca cggagacctt caggccagag ggaggcaaca 1380

tgaaggacaa ctggcgctcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaagaat 1500

tcggttacca ggtcccggat cc 1522

<210> SEQ ID NO 183

<211> LENGTH: 1519

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 183

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gcgcctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggcgtc gaactcctcc atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctggacgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacgggaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcgacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag gagtacttcc 1020

ccgacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgaa ctccaccgac atggccaact ccaccgagac caactccacg cgcatcatca 1200

cgctgcactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacgac accgacacgg agaccttcag gccagaggga ggcaacatga 1380

aggacaactg gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg 1440

tggcacccac caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taagaattcg 1500

gttaccggga cctggatcc 1519

<210> SEQ ID NO 184

<211> LENGTH: 1558

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 184

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggcgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggcggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgcca ccgcgtcgaa cgccaacgcg accgcaagca 420

acaccaacgc gacggtgtcg aactcctcca tcatcgagga gatgaagaac tgctccttca 480

acatcacgac ggagctgcgc gacaagcgcg agaagaagta cgccctgttc tacaagctgg 540

acatcgtgca gctggacggc aactcctcgc agtacaggct gatcaactgc aacacctccg 600

tcatcacgca ggcgtgcccc aaggtgtcct tcgaccccat ccccatccac tactgcgccc 660

ccgccggcta cgccatcctg aagtgcaaca acaagacctt caacggcacc ggcccgtgca 720

acaacgtgtc caccgtgcag tgcacgcacg ggatcaagcc cgtggtgtcc acgcagctgc 780

tcctgaacgg gtcgctggcc gagggcgaga tcatcatccg gtcggagaac atcacgaaca 840

gcgcgaagac catcatcgtg cacctgaacg agtccgtgaa gatcgagtgc acccgcccga 900

gcaacaacac gcgcacctcc atccggatcg gccctggcca ggccttctac gccaccggcc 960

aagtgatcgg cgacatccgc aaggcgcact gcaacatctc cgagtccaag tggaacgaga 1020

ccctgcagcg cgtgtccaag aagctgaagg agtacttccc ccacaagaac atcaccttcc 1080

agccgtcgtc cggcggcgac cccgagatca ccacgcactc cttcaactgc ggtggcgagt 1140

tcttctactg caacacgtcg tccctgttca accgcaccta catggcgaac tccaccgaga 1200

ccaactccac gcgcaccatc acgctgcact gccgcatcaa gcagatcatc aacatgtggc 1260

aggaggtggg ccgcgccatg tacgcaccgc ccatcgccgg caacatcacc tgcatctcca 1320

acatcaccgg cctcctgctg acccgcgacg gcggcgagaa cacccgggac ggaggcaaca 1380

acaacacgga gaccttcagg ccagggggag gcaacatgaa ggacaactgg cgctccgagc 1440

tgtacaagta caaggtggtg gaggtgaagc ccctgggcgt ggcacccacc aacgcccgcg 1500

agcgcgtcgt ggagcgcgag aaggagtagt aagaattcgg ttaccgggtc ctggatcc 1558

<210> SEQ ID NO 185

<211> LENGTH: 1537

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 185

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaaga 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

gcgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgcca ccgcgtcgaa cagctccatc atcaagggga 420

tgaactcgtc catgatcgag gagatgaaga actgctcctt caacatcacg acggagctgc 480

gcgacaagcg cgagaagaag aacgccctgt tctacaagct ggacatcgtg cagctggacg 540

gcaactcctc gcagtacagg ctgatcaact gcaacacctc cgtcatcacg caggcgtgcc 600

ccaaggtgtc cttcgacccc atccccatcc actactgcgc ccccgccggc tacgccatcc 660

tgaagtgcaa caacaagacc ttcaacggca ccggcccgtg caacaacgtg tccaccgtgc 720

agtgcacgca cgggatcaag cccgtggtgt ccacgcagct gctcctgaac gggtcgctgg 780

ccgagggcga gatcatcatc cggtcggaga acatcacgaa cagcgcgaag accatcatcg 840

tgcacctgaa cgagtccgtg aagatcgagt gcacccgccc gagcaacaac acgcgcacct 900

ccatccggat cggccctggc caggccttct acgccaccgg ccaggtgatc ggcgacatcc 960

gcaaggcgca ctgcaacatc tccgagtcca agtggaacga gaccctgcag cgcgtgtcca 1020

agaagctgaa ggagtacttc cccgaccgga acatcacctt ccagccgtcg tccggcggcg 1080

accccgagat caccacgcac tccttcaact gcggtggcaa gttcttctac tgcaacacgt 1140

cgtccctgtt caaccgcacc tacatggcca actcgacgga catggcgaac tccaccgaga 1200

ccaactccac gcgcatcatc acgatccggt gccgcatcaa gcagatcatc aacatgtggc 1260

aggaggtggg ccgcgccatg tacgcaccgc ccatcgccgg caacatcacc tgcatctcca 1320

acatcaccgg cctcctgctg acccgcgacg gaggcaacaa caacacggag accttcaggc 1380

cagtgggagg caacatgaag gacaactggc gctccaagct gtacaagtac aaggtggtgg 1440

aggtgaagcc cctgggcgtg gcacccacca aggcccgcga gcgcatggtg gagcgcgaga 1500

aggagtagta aggtgaccgg gacccgaatt cggatcc 1537

<210> SEQ ID NO 186

<211> LENGTH: 1555

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 186

gtcgacaaga agccaccatg cgcgtgatgg gccgccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctg tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgcca ccgcgtccaa cacgaacgcg acagcgtcca 420

acatcaacgc gacagcatcg aagaactcca tcatcgagga gatgaagaac tgctccttca 480

acatcacgac ggagctgcgc gacaagcgcg agaagaagta cgccctgttc tacaagctgg 540

acatcgtgca gctggacggc aactcctcgc agtacaggct gatcaactgc aacacctccg 600

tcatcacgca ggcgtgcccc aaggtgtcct tcgaccccat ccccatccac tactgcgccc 660

ccgccggcta cgccatcctg aagtgcaaca acaagacctt caacggcacc ggcccgtgca 720

acaacgtgtc caccgtgcag tgcacgcacg ggatcaagcc cgtggtgtcc acgcagctgc 780

tcctgaacgg gtcgctggcc gagggcgaga tcatcatccg gtcgaagaac atcacggaca 840

acgggaagac catcatcgtg cacctgaacg agtccgtgaa gatcgagtgc acccgcccga 900

gcaacaacac gcgcacctcc atccggatcg gccctggcca ggccttctac gccaccggcc 960

aagtgatcgg cgacatccgc gaggcgcact gcaacatctc cgagtccaag tggaacgaga 1020

ccctgcagcg cgtgtccaag aagctgaagg agtacttccc cgacaagaac atcaccttcc 1080

agtcgtcgtc cggcggcgac ccggagatca ccacgcactc cttcaactgc ggtggcgagt 1140

tcttctactg caacacgtcg tccctgttca accgcaccta catggcgaac tccaccgaca 1200

tggccaactc caccgagacc aactccacgc gcatcatcac gatccgctgc cgcatcaagc 1260

agatcatcaa catgtggcag gaggtgggcc gcgccatgta cgcaccgccc atcgccggca 1320

acatcacctg catctccaac atcaccggcc tcctgctgac ccgcgacggc ggcaactctt 1380

ccacggagac cttcaggcca gagggaggca acatgaagga caactggcgc tccgagctgt 1440

acaagtacaa ggtggtggag gtgaagcccc tgggcgtggc acccaccaac gcccgcgagc 1500

gcgtcgtgga gcgcgagaag gagtagtaag gtcaccggga cccgaattcg gatcc 1555

<210> SEQ ID NO 187

<211> LENGTH: 1558

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 187

gtcgacaaga agccaccatg aaggtgcggg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctgg 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggcggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgcca ccgcgtcgaa caccaacgcg accgcaagca 420

acatcaacgc gacggcgtcg aagtcctcca tcatcgagga gatgaagaac tgctccttca 480

acatcacgac ggagctgcgc gacaagcgcg agaagaagta cgccctgttc tacaagctgg 540

acatcgtgca gctggacggc aactcctcgc agtacaggct gatcaactgc aacacctccg 600

tcatcacgca ggcgtgcccc aaggtgtcct tcgaccccat ccccatccac tactgcgccc 660

ccgccggcta cgccatcctg aagtgcaaca acaagacctt caacggcacc ggcccgtgca 720

acaacgtgtc caccgtgcag tgcacgcacg ggatcaagcc cgtggtgtcc acgcagctgc 780

tcctgaacgg gtcgctggcc gagggcgaga tcatcatccg gtcggagaac atcacggaca 840

acagcaagac catcatcgtg cacctgaacg agtccgtgaa gatcgagtgc acccgcccga 900

gcaacaacac gcgcacctcc atccggatcg gccctggcca ggccttctac gccaccggcc 960

aagtgatcgg cgacatccgc gaggcgcact gcaacatctc cgagtccaag tggaacgaga 1020

ccctgcagcg cgtgtccaag aagctgaagg agtacttccc cgacaagaac atcaccttcc 1080

agccgtcgtc cggcggcgac cccgagatca ccacgcactc cttcaactgc ggtggcgagt 1140

tcttctactg caacacgtcg tccctgttca accgcaccta catggcgaac tccaccgaga 1200

ccaactccac gcgcaccatc acgctgcact gccgcatcaa gcagatcatc aacatgtggc 1260

aggaggtggg ccgcgccatg tacgcaccgc ccatcgccgg caacatcacc tgcatctcca 1320

acatcaccgg cctcctgctg acccgcgacg gcggcgagaa cacccgggac ggaggcaaca 1380

acaacacgga gaccttcagg ccagagggag gcaacatgaa ggacaactgg cgctccgagc 1440

tgtacaagta caaggtggtg gaggtgaagc ccctgggcgt ggcacccacc aaggcccgcg 1500

agcgcgtcgt ggagcgcgag aaggagtagt aaggtaaccg ggacccgaat tcggatcc 1558

<210> SEQ ID NO 188

<211> LENGTH: 1537

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 188

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggcggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgcca ccgcttcgaa catcaacgcg acggcgtcga 420

agtcctccat catcgaggag atgaagaact gctccttcaa catcacgacg gagctgcgcg 480

acaagcgcga gaagaagtac gccctgttct acaagctgga catcgtgcag ctggacggca 540

actcctcgca gtacaggctg atcaactgca acacctccgt catcacgcag gcgtgcccca 600

aggtgtcctt cgaccccatc cccatccact actgcgcccc cgccggctac gccatcctga 660

agtgcaacaa caagaccttc aacggcaccg gcccgtgcaa caacgtgtcc accgtgcagt 720

gcacgcacgg gatcaagccc gtggtgtcca cgcagctgct cctgaacggg tcgctggccg 780

agggcgagat catcatccgg tcggagaaca tcacggacaa cagcaagacc atcatcgtgc 840

acctgaacga gtccgtgaag atcgagtgca cccgcccgag caacaacacg cgcacctcca 900

tccggatcgg ccctggccag gccttctacg ccaccggcca agtgatcggc gacatccgcg 960

aggcgcactg caacatctcc gagtccaagt ggaacgagac cctgcagcgc gtgtccaaga 1020

agctgaagga gtacttcccc gacaagaaca tcaccttcca gccgtcgtcc ggcggcgacc 1080

ccgagatcac cacgcactcc ttcaactgcg gtggcgagtt cttctactgc aacacgtcgt 1140

ccctgttcaa ccgcacctac atggcgaact ccaccgagac caactccacg cgcaccatca 1200

cgctgcactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcgagaac acccgggacg gaggcaacaa caacacggag accttcaggc 1380

cagagggagg caacatgaag gacaactggc gctccgagct gtacaagtac aaggtggtgg 1440

aggtgaagcc cctgggcgtg gcacccacca aggcccgcga gcgcgtcgtg gagcgcgaga 1500

aggagtagta aggttaccgg gacccgaatt cggatcc 1537

<210> SEQ ID NO 189

<211> LENGTH: 1570

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 189

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgacctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgcca ccgcgtcgaa cacgaacgcg accgcaagca 420

acatcaacgc gacggcgtcg aagtcctcca tcatcgagga gatgaagaac tgctccttca 480

acatcacgac ggagctgcgc gacaagcgcg agaagaagta cgccctgttc tacaagctgg 540

acatcgtgca gctggacggc aactcctcgc agtacaggct gatcaactgc aacacctccg 600

tcatcacgca ggcgtgcccc aaggtgtcct tcgaccccat ccccatccac tactgcgccc 660

ccgccggcta cgccatcctg aagtgcaaca acaagacctt caacggcacc ggcccgtgca 720

acaacgtgtc caccgtgcag tgcacgcacg ggatcaagcc cgtggtgtcc acgcagctgc 780

tcctgaacgg gtcgctggcc gagggcgaga tcatcatccg gtcgaagaac atcacggaca 840

acgggaagac catcatcgtg cacctgaacg agtccgtgaa gatcgagtgc acccgcccga 900

gcaacaacac gcgcacctcc atccggatcg gccctggcca ggccttctac gccaccggcc 960

aagtgatcgg cgacatccgc gaggcgcact gcaacatctc cgagtccaag tggaacgaga 1020

ccctgcagcg cgtgtccaag aagctgaagg agtacttccc cgacaagaac atcaccttcc 1080

agtcctcgtc cggcggcgac cccgagatca ccacgcactc cttcaactgc ggtggcgagt 1140

tcttctactg caacacgtcg tccctgttca accgcaccta catggcgaac tcgacggaca 1200

tggccaactc caccgagacc aactccacgc gcatcatcac gatccactgc cgcatcaagc 1260

agatcatcaa catgtggcag gaggtgggcc gcgccatgta cgcaccgccc atcgccggca 1320

acatcacctg catctccaac atcaccggcc tcctgctgac ccgcgacggc ggcgagaaca 1380

acggaggcaa gaacaacacg gagaccttca ggccaggggg aggcaacatg aaggacaact 1440

ggcgctccga gctgtacaag tacaaggtgg tggaggtgaa gcccctgggc gtggcaccca 1500

ccaaggcccg cgagcgcgtc gtggagcgcg agaaggagta gtaaggtgac cgggtcccga 1560

attcggatcc 1570

<210> SEQ ID NO 190

<211> LENGTH: 1540

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 190

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggcgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgcca ccgcgtcgaa cacgaacgcg accgtcagca 420

acatcaaggc gacggtgtcg aactcctcca tcatcgagga gatgaagaac tgctccttca 480

acatcacgac ggagctgcgc gacaagatcg agaagaagta cgccctgttc tacaagctgg 540

acatcgtgca gctggacggc aactccacgc agtaccgctt catcaactgc aacacctccg 600

cgatcacgca ggcgtgcccc aaggtgtcct tcgaccccat ccccatccac tactgcgccc 660

ccgccggcta cgccatcctg aagtgcaaca acaagacctt caacggcacc ggcccgtgca 720

acaacgtgtc caccgtgcag tgcacgcacg ggatcaagcc cgtggtgtcc acgcagctgc 780

tcctgaacgg gtcgctggcc gagggcgaga tcatcatccg gtcggagaac atcacggaca 840

acgggaagac catcatcgtg cacctgaacg agtccgtgaa gatcgagtgc acccgcccgg 900

ggaacaacac gcgcacctcc atccggatcg gccctggcca ggccttctac gccaccggcc 960

aagtgatcgg cgacatccgc caggcgcact gcaacatctc cgagtccaag tggaacgaga 1020

ccctgcagcg cgtgtccgag aagctgaagg agtacttccc caacaagacg atcaccttcc 1080

agccgtcgtc cggcggcgac cccgagatca ccacgcactc cttcaactgc ggtggcgagt 1140

tcttctactg caacacgtcg tccctgttca accgcaccta catggcgaac tccaccgaga 1200

ccaactccac gcgcaccatc acgctccact gccgcatcaa gcagatcatc aacatgtggc 1260

aggaggtggg ccgcgccatg tacgcaccgc ccatcgccgg caacatcacc tgcatctcca 1320

acatcaccgg cctcctgctg acccgcgacg gcggcaacac gaccgacatc gagaccttca 1380

ggccaggggg aggcaacatg aaggacaact ggcgctccga gctgtacaag tacaaggtgg 1440

tggaggtgaa gcccctgggc gtggcaccca ccaaggcccg cgagcgcgtc gtggagcgcg 1500

agaaggagta gtaaggtgac caggacccga attcggatcc 1540

<210> SEQ ID NO 191

<211> LENGTH: 1546

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 191

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggcgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgcca ccgcgtcgaa cgccaacgcg accgccagca 420

acacgaacgc gacggtgtcg aacgactcct ccatcatcga ggagatgaag aactgctcct 480

tcaacatcac gacggagctg cgcgacaaga tcgagaagaa gtacgccctg ttctacaagc 540

tggacatcgt gcagctggac ggcaactcca cgcagtaccg cttcatcaac tgcaacacct 600

ccgcgatcac gcaggcgtgc cccaaggtgt ccttcgaccc catccccatc cactactgcg 660

cccccgccgg ctacgccatc ctgaagtgca acaacaagac cttcaacggc accggcccgt 720

gcaacaacgt gtccaccgtg cagtgcacgc acgggatcaa gcccgtggtg tccacgcagc 780

tgctcctgaa cgggtcgctg gccgagggcg agatcatcat ccggtcgaag aacatcacgg 840

acaacgggaa caccatcatc gtgcacctga acgagtccgt gaagatcgag tgcacccgcc 900

cgtccaacaa cacgcgcacc tccatccgga tcggccctgg ccaggccttc tacgccaccg 960

gccaagtgat cggcgacatc cgccaggcgc actgcaacat ctccgagtcc aagtggaacg 1020

agaccctgca gcgcgtgtcc gagaagctga aggagtactt ccccgacaag aacatcacct 1080

tccagccgtc gtccggcggc gaccccgaga tcaccacgca ctccttcaac tgcggtggcg 1140

agttcttcta ctgcaacacg tcgtccctgt tcaaccgcac ctacatggcg aactccaccg 1200

agaccaactc cacgcgcacc atcacgctcc actgccgcat caagcagatc atcaacatgt 1260

ggcaggaggt gggccgcgcc atgtacgcac cgcccatcgc cggcaacatc acctgcatct 1320

ccaacatcac cggcctcctg ctgacccgcg acggcggcaa ctcgtccaag gagaccgaga 1380

ccttcaggcc agggggaggc aacatgaagg acaactggcg ctccgagctg tacaagtaca 1440

aggtggtgga ggtgaagccc ctgggcgtgg cacccaccaa cgcccgcgag cgcgtcgtgg 1500

agcgcgagaa ggagtagtaa ggtgaccagg tcccgaattc ggatcc 1546

<210> SEQ ID NO 192

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 192

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg cagctacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggactc gaactccaac atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacgt 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag aagtacttcc 1020

ccgacaagaa catcaccttc cggccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgac ctccacggac atggccaact ccaccgagac gaactccacg cgcatcatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagag ggaggcaaca 1380

tgaaggacaa ctggcgctcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaaggtg 1500

accgggacct gaattcggat cc 1522

<210> SEQ ID NO 193

<211> LENGTH: 1525

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 193

gtcgacaaga agccaccatg cgcgtgatgg gcacccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggcggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgta ctgcatcaac gccaccgcca acgcgacggt ctcgaactcc tcgatcatcg 420

aggagatgaa gaactgctcc ttcaacatca cgacggagct gcgcgacaag cgcgagaaga 480

agaacgccct gttctacaag ctggacatcg tgcagctgga cggcaactcc tcgcagtaca 540

ggctgatcaa ctgcaacacc tccgcgatca cgcaggcgtg ccccaaggtg tccttcgacc 600

ccatccccat ccactactgc gcccccgccg gctacgccat cctgaagtgc aacaacaaga 660

ccttcaacgg caccggcccg tgcaacaacg tgtccaccgt gcagtgcacg cacgggatca 720

agcccgtggt gtccacgcag ctgctcctga acgggtcgct ggccgagggc gagatcatca 780

tccggtcgga gaacatcacg aacagcgcga agaccatcat cgtgcacctg aacgagtccg 840

tgaagatcga gtgcacccgc ccgagcaaca acacgcgcac ctccatccgg atcggccctg 900

gccaggcctt ctacgccacc ggccaggtga tcggcgacat ccgccaggcg cactgcaaca 960

tctccgagtc caagtggaac gagaccctgc agcgcgtgtc cgagaagctg aaggagtact 1020

tccccaacaa gacgatcacc ttccagccgt cgtccggcgg cgaccccgag atcaccacgc 1080

actccttcaa ctgcggtggc gagttcttct actgcaacac gtcgtccctg ttcaaccgca 1140

cctacatggc gaactccacc gacatggcca actccaccga gacgaactcc acgcgcacca 1200

tcacgctcca ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca 1260

tgtacgcacc gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc 1320

tgacccgcga cggcggcaac agctccaagg agacggagac cttcaggcca gggggaggca 1380

acatgaagga caactggcgc tccgagctgt acaagtacaa ggtggtggag gtgaagcccc 1440

tgggcgtggc acccaccaac gcccgcgagc gcgtcgtgga gcgcgagaag gagtagtaag 1500

gtgaccgggt cctgaattcg gatcc 1525

<210> SEQ ID NO 194

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 194

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg cagctacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggactc gaactccaac atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag aagtacttcc 1020

ccgacaagaa catcaccttc cggccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgac gtccaccgac atggccaact ccaccgagac gaactccacg cgcatcatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagag ggaggcaaca 1380

tgaaggacaa ctggcgctcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaaggtc 1500

accgggtccc gaattcggat cc 1522

<210> SEQ ID NO 195

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 195

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg cagctacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgag ctgcatcaac gccaccaacg cgacggactc gaacaactcc atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgtacgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacgggaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag gagtacttcc 1020

ccgacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgac gtccaccgac atggccaact ccaccgagac caactccacg cgcatcatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagag ggaggcaaca 1380

tgaaggacaa ctggcgctcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaaggtc 1500

accaggaccc gaattcggat cc 1522

<210> SEQ ID NO 196

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 196

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggactc gaactccaac atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggacggag accctgcagc gcgtgtccga gaagctgaag aagtacttcc 1020

ccgacaagaa catcaccttc cggccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgac gtccaccgac atggccaact ccaccgagat caactccacg cgcatcatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagag ggaggcaaca 1380

tgaaggacaa ctggcgctcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaaggtc 1500

accaggtccc gaattcggat cc 1522

<210> SEQ ID NO 197

<211> LENGTH: 1543

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 197

gtcgacaaga agccaccatg cgcgtgatgg gccggcagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga cgccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgaca ccgcgtcgaa cagctccatc atcaagggga 420

tgaacaactc catcgtgggg gagatgaaga actgctcctt caacatcacg acggagctgc 480

gcgacaagcg cgagaagaag aacgccctgt tctacaagct ggacatcgtg cagctggacg 540

gcaactcctc ggagtacagg ctgatcaact gcaacacctc cgtcatcacg caggcgtgcc 600

ccaaggtgtc cttcgacccc atccccatcc actactgcgc ccccgccggc tacgccatcc 660

tgaagtgcaa caacaagacc ttcaacggca ccggcccgtg caacaacgtg tccaccgtgc 720

agtgcacgca cgggatcaag cccgtggtgt ccacgcagct gctcctgaac gggtcgctgg 780

ccgagggcga gatcatcatc cggtcggaga acatcacgga caacgcgaag accatcatcg 840

tgcacctgaa cgagtccgtg aagatcgagt gcacccgccc gagcaacaac acgcgcacct 900

ccatccggat cggccctggc caggccttct acgccaccgg ccaggtgatc ggcgacatcc 960

gcaaggcgca ctgcaacatc tccgagtcca agtggaacga gaccctgcag cgcgtgtcca 1020

agaagctgaa ggagtacttc cccgacaaga acatcacctt ccagccgtcg tccggcggcg 1080

accccgagat caccacgcac tccttcaact gcggtggcga gttcttctac tgcaacacgt 1140

cgtccctgtt caaccgcacc tacatggcca actcgacgga catggcgaac tccgcggaga 1200

ccaactccac gcgcaccatc acgctccact gccgcatcaa gcagatcatc aacatgtggc 1260

aggaggtggg ccgcgccatg tacgcaccgc ccatcgccgg caacatcacc tgcatctcca 1320

acatcaccgg cctcctgctg acccgcgacg gaggcaactc cagcacggag acggagacct 1380

tcaggccagg gggaggcaac atgaaggaca actggcgctc cgagctgtac aagtacaagg 1440

tggtggaggt gaagcccctg ggcgtggcac ccaccaacgc ccgcgagcgc gtggtggagc 1500

gcgagaagga gtagtaaggt caccgggacc tgaattcgga tcc 1543

<210> SEQ ID NO 198

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 198

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg cagctacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggcggg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggactc gaactccaac atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccaa gaagctgaag aagtacttcc 1020

ccgacaagaa catcaccttc cggccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgac gtccatcgac atggccaact ccaccgagac gaactccacg cgcatcatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagag ggaggcaaca 1380

tgaaggacaa ctggcgctcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaaggtc 1500

accgggtcct gaattcggat cc 1522

<210> SEQ ID NO 199

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 199

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggcgtc gaactccaac atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag gagtacttcc 1020

ccgacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgaa ctccacggac atggccaact ccaccgagac gaactccacg cgcatcatca 1200

cgctccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagag ggaggcaaca 1380

tgaaggacaa ctggcgctcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaaggta 1500

accgggtccc gaattcggat cc 1522

<210> SEQ ID NO 200

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 200

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggactc gaactccaac atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag aagtacttcc 1020

ccgacaagaa catcaccttc cggccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgac ctccacggac atggccaact ccaccgagac gaactccacg cgcatcatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagag ggaggcaaca 1380

tgaaggacaa ctggcgctcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaaggta 1500

accaggaccc gaattcggat cc 1522

<210> SEQ ID NO 201

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 201

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg cagctacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggactc gaactccaac atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaaggcgt 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag aagtacttcc 1020

ccgacaagaa catcaccttc cggccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgac ctccacggac atggccaact ccaccgagac gaactccacg cgcatcatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagag ggaggcaaca 1380

tgaaggacaa ctggcgctcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaaggta 1500

accaggtccc gaattcggat cc 1522

<210> SEQ ID NO 202

<211> LENGTH: 1519

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 202

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggactc gaagtccaac atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg gaactccaac agctcgcagt 540

acaggctgat caactgcaac acctccgtca tcacgcaggc gtgccccaag gtgtccttcg 600

accccatccc catccactac tgcgcccccg ccggctacgc catcctgaag tgcaacaaca 660

agaccttcaa cggcaccggc ccgtgcaaca acgtgtccac cgtgcagtgc acgcacggga 720

tcaagcccgt ggtgtccacg cagctgctcc tgaacgggtc gctggccgag ggcgagatca 780

tcatccggtc caagaacatc acggacaaca gcaagaccat catcgtgcac ctgaacgagt 840

ccgtgaagat cgagtgcacc cgcccgagca acaacacgcg cacctccatc cggatcggcc 900

ctggccaggc cttctacgcc accggccagg tgatcggcaa catccgcgag gcgcactgca 960

acatctccga gtccaagtgg aacgagaccc tgcagcgcgt gtccgagaag ctgaaggagt 1020

acttccccca gaagaacatc accttccagc cgtcgtccgg cggcgacctc gagatcacca 1080

cgcactcctt caactgcggt ggcgagttct tctactgcaa cacgtcgtcc ctgttcaacc 1140

gcacctacat ggcgacgggc accgacatgg ccaactccac cgagacgaac atcatcacga 1200

tccactgccg catcaagcag atcatcaaca tgtggcagga ggtgggccgc gccatgtacg 1260

caccgcccat cgccggcaac atcacctgca tctccaacat caccggcctc ctgctgaccc 1320

gcgacggcgg caactccacg gaggacacgg agaccttcag gccagtggga ggcaacatga 1380

aggacaactg gtcgtccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg 1440

tggcacccac caacgcccgc gagcgcgtcg tggagcgcga gaaggagtag taaggtaacc 1500

gggacctgaa ttcggatcc 1519

<210> SEQ ID NO 203

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 203

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg cagctacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggcctc ggactcctcg atcctcgacg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggctc caacagctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag gagtacttcc 1020

ccgacaagaa gatcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgaa cagcaccgac atggccaact ccaccgagac gaactcgacg cagatcatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagtg ggaggcaaca 1380

tgaaggacaa ctggtcgtcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaaggta 1500

accgggtcct gaattcggat cc 1522

<210> SEQ ID NO 204

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 204

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg cagctacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggactc gaagtccaac atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg gaacagctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag gagtacttcc 1020

ccgacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgaa cagcaccgac atggccaact ccaccgagac gaactcgacg cagatcatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagtg ggaggcaaca 1380

tgaaggacaa ctggtcgtcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaaggcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaaggtt 1500

accgggtccc gaattcggat cc 1522

<210> SEQ ID NO 205

<211> LENGTH: 1513

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 205

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gcggctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggcctc ggactccagc atcctcgacg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg gaactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag aagtacttcc 1020

ccgacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgac gtccaccgac ctcgccaact ccaccgagac gaacatcatc acgatccact 1200

gccgcatcaa gcagatcatc aacatgtggc aggaggtggg ccgcgccatg tacgcaccgc 1260

ccatcgccgg caacatcacc tgcatctcca acatcaccgg cctcctgctg acccgcgacg 1320

gcggcaacaa cacggaggac acggagacct tcaggccagt gggaggcaac atgaaggaca 1380

actggtcgtc cgagctgtac aagtacaagg tggtggaggt gaagcccctg ggcgtggcac 1440

ccaccaacgc ccgcgagcgc gtcgtgaaga gggagaagga gtagtaaggt taccaggacc 1500

cgaattcgga tcc 1513

<210> SEQ ID NO 206

<211> LENGTH: 1558

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 206

gtcgacaaga agccaccatg cgcgtgatgg gcaggcagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggg ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgcca ccgcgtcgaa cgccaacgcg accgtgagca 420

acacgaacgc gacggtgtcg aacgactcct ccatcatcga ggagatgaag aactgctcct 480

tcaacatcac gacggagctg cgcgacaaga tcgagaagaa gtacgccctg ttctacaagc 540

tggacatcgt gcagctggac ggcaactcca cgcactaccg cttcatcaac tgcaacacct 600

ccgcgatcac gcaggcgtgc cccaaggtgt ccttcgaccc catccccatc cactactgcg 660

cccccgccgg ctacgccatc ctgaagtgca acaacaagac cttcaacggc accggcccgt 720

gcaacaacgt gtccaccgtg cagtgcacgc acgggatcaa gcccgtggtg tccacgcagc 780

tgctcctgaa cgggtcgctg gccgagggcg agatcatcat ccggtcgaag aacatcacgg 840

acaacgggaa gaccatcatc gtgcacctga acgagtccgt gaagatcgag tgcacccgcc 900

cgtccaacaa cacgcgcacc tccatcggga tcggccctgg ccaggccttc tacgccaccg 960

gccaggtcat cggcgacatc cgcaaggcgc actgcaacat ctccgagtcc aagtggaacg 1020

agaccctgca gcgcgtgtcc aagaagctga aggagtactt ccccggcaag aacatcacct 1080

tccagccgtc gtccggcggc gaccccgaag tgaccacgca ctccttcaac tgcggtggcg 1140

agttcttcta ctgcaacacg tcgtccctgt tcaaccgcac ctacatgacg aacagcacgg 1200

acatggcgaa ctccaccgag accaaccgca ccatcacgat ccactgccgc atcaagcaga 1260

tcatcaacat gtggcaggag gtgggccgcg ccatgtacgc accgcccatc gccggcaaca 1320

tcacctgcat ctccaacatc accggcctcc tgctgacccg cgacggcggc aactcgtcca 1380

cggagaccga gaccttcagg ccagagggag gcaacatgaa ggacaactgg cgctccgagc 1440

tgtacaagta caaggtggtg gaggtgaagc ccctgggcgt ggcacccacc aacgcccgcg 1500

agcgcgtcgt ggagcgcgag aaggagtagt aaggttacca ggtcccgaat tcggatcc 1558

<210> SEQ ID NO 207

<211> LENGTH: 1522

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 207

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg cagctacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggactc gaagtccaac atcctcgagg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggctc caacagctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag gagtacttcc 1020

ccgacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgaa cagcaccgac atggccaact ccaccgagac gaactcgacg cagatcatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagtg ggaggcaaca 1380

tgaaggacaa ctggtcgtcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagcg cgagaaggag tagtaaggtt 1500

accgggacct gaattcggat cc 1522

<210> SEQ ID NO 208

<211> LENGTH: 1513

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 208

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg cagctacccg cagtggtgga 60

tctggtcgat gctgggcctc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gcggctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggcctc ggactccagc atcctcgacg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg gaactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag aagtacttcc 1020

ccgacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgac gtccaccgac atggccaact ccaccgagac gaacatcatc acgatccact 1200

gccgcatcaa gcagatcatc aacatgtggc aggaggtggg ccgcgccatg tacgcaccgc 1260

ccatcgccgg caacatcacc tgcatctcca acatcaccgg cctcctgctg acccgcgacg 1320

gcggcaacaa cacggaggac acggagacct tcaggccagt gggaggcaac atgaaggaca 1380

actggtcgtc cgagctgtac aagtacaagg tggtggaggt gaagcccctg ggcgtggcac 1440

ccaccaacgc ccgcgagcgc gtcgtggaga gggagaagga gtagtaaggt taccgggtcc 1500

tgaattcgga tcc 1513

<210> SEQ ID NO 209

<211> LENGTH: 1539

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 209

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg cagctacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcatgtgg gtgacggtgt 120

actacggcgt gccggtgtgg aaggaggcca agacgaccct gttctgcgcg tcggacgcca 180

aggcctacga gaaggaggtg cacaacgtgt gggcgaccca cgcctgcgtg cccacggacc 240

ccaacccgca ggagatggtg ctgaagaacg tgaccgagaa cttcaacatg tgggagaacg 300

acatggtgga ccagatgcac gaggacgtga tctccctgtg ggaccagtcc ctgaagccct 360

gcgtgaagct gaccccgctg tgcgtgaccc tgaactgcat caacgccacc aacgcgacgg 420

cctcggactc cagcatcctc gacgggatga agaactgctc cttcaacatc acgacggagc 480

tgcgcgacaa gcgcgagaag aagaacgccc tgttctacaa gctggacatc gtgcagctgg 540

gcagcaactc ctcgcagtac aggctgatca actgcaacac ctccgtcatc acgcaggcgt 600

gccccaaggt gtccttcgac cccatcccca tccactactg cgcccccgcc ggctacgcca 660

tcctgaagtg caacaacaag accttcaacg gcaccggccc gtgcaacaac gtgtccaccg 720

tgcagtgcac gcacgggatc aagcccgtgg tgtccacgca gctgctcctg aacgggtcgc 780

tggccgaggg cgagatcatc atccggtcga agaacatcac ggacaacagc aagaccatca 840

tcgtgcacct gaacgagtcc gtgaagatcg agtgcacccg cccgagcaac aacacgcgca 900

cctccatccg gatcggccct ggccaggcct tctacgccac cggccaggtg atcggcaaca 960

tccgcgaggc gcactgcaac atctccgagt ccaagtggaa cgagaccctg cagcgcgtgt 1020

ccgagaagct gaaggagtac ttccccgaca agaacatcac cttccagccg tcgtccggcg 1080

gcgacctcga gatcaccacg cactccttca actgcggtgg cgagttcttc tactgcaaca 1140

cgtcgtccct gttcaaccgc acctacatgg cgaactccac cgacatggcc aactccaccg 1200

agacgaacag cacgcagatc atcacgatcc actgccgcat caagcagatc atcaacatgt 1260

ggcaggaggt gggccgcgcc atgtacgcac cgcccatcgc cggcaacatc acctgcatct 1320

ccaacatcac cggcctcctg ctgacccgcg acggcggcaa caacacggag gacacggaga 1380

ccttcaggcc agtgggaggc aacatgaagg acaactggtc gtccgagctg tacaagtaca 1440

aggtggtgga ggtgaagccc ctgggcgtgg cacccaccaa cgcccgcgag cgcgtcgtgg 1500

agagggagaa ggagtagtaa ggtgaccgaa ttcggatcc 1539

<210> SEQ ID NO 210

<211> LENGTH: 1515

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 210

gtcgacaaga agccaccatg cgcgtgcgcg gcatccagcg cagctacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcatcaac gccaccaacg cgacggcctc ggactccagc atcctcgacg 420

ggatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctgggcgg gaactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaacggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtcgaagaa catcacggac aacagcaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaca cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcaacatccg cgaggcgcac tgcaacatct 960

ccgagtccaa gtggaacgag accctgcagc gcgtgtccga gaagctgaag gagtacttcc 1020

ccgacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtccctgttc aaccgcacct 1140

acatggcgaa ctccaccgac atggccaact ccaccgagac gaacagcacg cagatcatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaacaac acggaggaca cggagacctt caggccagtg ggaggcaaca 1380

tgaaggacaa ctggtcgtcc gagctgtaca agtacaaggt ggtggaggtg aagcccctgg 1440

gcgtggcacc caccaacgcc cgcgagcgcg tcgtggagag ggagaaggag tagtaaggtc 1500

accgaattcg gatcc 1515

<210> SEQ ID NO 211

<211> LENGTH: 1548

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 211

gtcgacaaga agccaccatg cgcgtgatgg gcaggcagcg caactacccg cagtggtgga 60

tctggagcac gctgggcctc aggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc gtacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtggg agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcacggac gccaacgcca ccgcgtcgaa cgccaacgcg accgtgagca 420

acacgaacgc gacggtgtcg aacgactcct ccatcatcga ggagatgaag aactgctcct 480

tcaacatcac gacggagctg cgcgacaaga tcgagaagaa gtacgccctg ttctacaagc 540

tggacatcgt gcagctggac ggcaactcca cgcactaccg cttcatcaac tgcaacacct 600

ccgcgatcac gcaggcgtgc cccaaggtgt ccttcgaccc catccccatc cactactgcg 660

cccccgccgg ctacgccatc ctgaagtgca acaacaagac cttcaacggc accggcccgt 720

gcaacaacgt gtccaccgtg cagtgcacgc acgggatcaa gcccgtggtg tccacgcagc 780

tgctcctgaa cgggtcgctg gccgagggcg agatcatcat ccggtcggag aacatcacgg 840

acaacgcgaa gaccatcatc gtgcacctga acgagtccgt gaagatcgag tgcacccgcc 900

cgtccaacaa cacgcgcacc tccatcggga tcggccctgg ccaggccttc tacgccaccg 960

gccaggtcat cggcgacatc cgcaaggcgc actgcaacat ctccgagtcc aagtggaacg 1020

agaccctgca gcgcgtgtcc aagaagctga aggagtactt ccccggcaag aacatcacct 1080

tccagccgtc gtccggcggc gaccccgaag tgaccacgca ctccttcaac tgcggtggcg 1140

agttcttcta ctgcaacacg tcgtccctgt tcaaccgcac ctacatgacg aacagcacgg 1200

acatggcgaa ctccaccgag accaaccgca ccatcacgat ccactgccgc atcaagcaga 1260

tcatcaacat gtggcaggag gtgggccgcg ccatgtacgc accgcccatc gccggcaaca 1320

tcacctgcat ctccaacatc accggcctcc tgctgacccg cgacggcggc aacaacacgg 1380

accccgagat cttcaggcca ggcggaggca acatgaagga caactggcgc tccgagctgt 1440

acaagtacaa ggtggtggag gtgaagcccc tgggcgtggc acccaccaac gcccgcgagc 1500

gcgtcgtgga gcgcgagaag gagtagtaag gtaaccgaat tcggatcc 1548

<210> SEQ ID NO 212

<211> LENGTH: 1471

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 212

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccaac gccaccgcga acaactccaa catcatcgag gagatgaaga 420

actgctcctt caacatcacg acggagctgc gcgacaagcg cgagaagaag aacgccctgt 480

tctacaagct ggacatcgtg cagctggacg gcaactcctc gcagtacagg ctgatcaact 540

gcaacacctc cgtcatcacg caggcgtgcc ccaaggtgtc cttcgacccc atccccatcc 600

actactgcgc ccccgccggc tacgccatcc tgaagtgcaa caacaagacc ttcaccggca 660

ccggcccgtg caacaacgtg tccaccgtgc agtgcacgca cgggatcaag cccgtggtgt 720

ccacgcagct gctcctgaac gggtcgctgg ccgagggcga gatcatcatc cggtccgaga 780

acatcacgaa caacgtgaag accatcatcg tgcacctgaa cgagtccgtg aagatcgagt 840

gcacccgccc gaacaacaag acgcgcacct ccatccggat cggccctggc caggccttct 900

acgccaccgg ccaggtgatc ggcgacatcc gcgaggcgta ctgcaacatc aacgagtcca 960

agtggaacga gaccctgcag cgcgtgtcca agaagctgaa ggagtacttc ccccacaaga 1020

acatcacctt ccagccgtcg tccggcggcg acctcgagat caccacgcac tccttcaact 1080

gcggtggcga gttcttctac tgcaacacgt cgtcgctgtt caaccgcacc gacatggcca 1140

actccaccga gaccaactcc acgcgcacca tcacgatcca ctgccgcatc aagcagatca 1200

tcaacatgtg gcaggaggtg ggccgcgcca tgtacgcacc gcccatcgcc ggcaacatca 1260

cctgcatctc caacatcacc ggcctcctgc tgacccgcga cggcggcaag aacaacacgg 1320

agaccttcag gccaggcgga ggcaacatga aggacaactg gcgctccgag ctgtacaagt 1380

acaaggtggt ggaggtgaag cccctgggcg tggcacccac caacgcccgc gagcgcgtcg 1440

tggagcgcga gaaggagtag taagtggatc c 1471

<210> SEQ ID NO 213

<211> LENGTH: 1497

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 213

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccaac gccaccgcgt ccaactcctc catcatcgag ggcatgaaga 420

actgctcctt caacatcacg acggagctgc gcgacaagcg cgagaagaag aacgccctgt 480

tctacaagct ggacatcgtg cagctggacg gcaactcctc gcagtacagg ctgatcaact 540

gcaacacctc cgtcatcacg caggcgtgcc ccaaggtgtc cttcgacccc atccccatcc 600

actactgcgc ccccgccggc tacgccatcc tgaagtgcaa caacaagacc ttcaccggca 660

ccggcccgtg caacaacgtg tccaccgtgc agtgcacgca cgggatcaag cccgtggtgt 720

ccacgcagct gctcctgaac gggtcgctgg ccgagggcga gatcatcatc cggtccgaga 780

acatcacgaa caacgtgaag accatcatcg tgcacctgaa cgagtccgtg aagatcgagt 840

gcacccgccc gaacaacaag acgcgcacct ccatccggat cggccctggc caggccttct 900

acgccaccgg ccaggtgatc ggcgacatcc gcgaggcgta ctgcaacatc aacgagtcca 960

agtggaacga gaccctgcag cgcgtgtcca agaagctgaa ggagtacttc ccccacaaga 1020

acatcacctt ccagccgtcg tccggcggcg acctcgagat caccacgcac tccttcaact 1080

gcggtggcga gttcttctac tgcaacacgt cgtcgctgtt caaccgcacc tacatggcca 1140

actccaccga catggccaac tccaccgaga ccaactccac gcgcaccatc acgatccact 1200

gccgcatcaa gcagatcatc aacatgtggc aggaggtggg ccgcgccatg tacgcaccgc 1260

ccatcgccgg caacatcacc tgcatctcca acatcaccgg cctcctgctg acccgcgacg 1320

gcggcaagaa caacacggag accttcaggc caggcggagg caacatgaag gacaactggc 1380

gctccgagct gtacaagtac aaggtggtgg aggtgaagcc cctgggcgtg gcacccacca 1440

acgtccgcga gcgcgtcgtg gagcgcgaga aggagtgata gtaagaacgt cggatcc 1497

<210> SEQ ID NO 214

<211> LENGTH: 1514

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 214

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccaac gcgaccaacg ccaccgcgtc caactcctcc atcatcgagg 420

gcatgaagaa ctgctccttc aacatcacga cggagctgcg cgacaagcgc gagaagaaga 480

acgccctgtt ctacaagctg gacatcgtgc agctggacgg caactcctcg cagtacaggc 540

tgatcaactg caacacctcc gtcatcacgc aggcgtgccc caaggtgtcc ttcgacccca 600

tccccatcca ctactgcgcc cccgccggct acgccatcct gaagtgcaac aacaagacct 660

tcaccggcac cggcccgtgc aacaacgtgt ccaccgtgca gtgcacgcac gggatcaagc 720

ccgtggtgtc cacgcagctg ctcctgaacg ggtcgctggc cgagggcgag atcatcatcc 780

ggtccgagaa catcacgaac aacgacaaga ccatcatcgt gcacctgaac gagtccgtga 840

agatcgagtg cacccgcccg agcaacaaga cgcgcacctc catccggatc ggccctggcc 900

aggccttcta cgccaccggc caggtgatcg gcgacatccg cgaggcgtac tgcaacatca 960

gcgagtccaa gtggaacgag accctgcagc gcgtgtccaa gaagctgaag gagtacttcc 1020

cccacaagaa catcaccttc cagccgtcgt ccggcggcga cctcgagatc accacgcact 1080

ccttcaactg cggtggcgag ttcttctact gcaacacgtc gtcgctgttc aaccgcacct 1140

acatggccaa ctccaccgac atggccaact ccaccgagac caactccacg cgcaacatca 1200

cgatccactg ccgcatcaag cagatcatca acatgtggca ggaggtgggc cgcgccatgt 1260

acgcaccgcc catcgccggc aacatcacct gcatctccaa catcaccggc ctcctgctga 1320

cccgcgacgg cggcaagaac gacacggaga ccttcaggcc aggcggaggc aacatgaagg 1380

acaactggcg ctccgagctg tacaagtaca aggtggtgga ggtgaagccc ctgggcgtgg 1440

cacccaccaa cgcccgcgag cgcgtcgtgg agcgcgagaa ggagtgatag taagaggtcc 1500

cggtaaccgg atcc 1514

<210> SEQ ID NO 215

<211> LENGTH: 1515

<212> TYPE: DNA

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polynucleotide

<400> SEQUENCE: 215

gtcgacaaga agccaccatg cgcgtgatgg gcatccagcg caactacccg cagtggtgga 60

tctggtcgat gctgggcttc tggatgctca tgatctgcaa cggcgtgccg gtgtggaagg 120

aggccaagac gaccctgttc tgcgcgtcgg acgccaaggc ctacgagaag gaggtgcaca 180

acgtgtgggc gacccacgcc tgcgtgccca cggaccccaa cccgcaggag atggtgctga 240

agaacgtgac cgagaacttc aacatgtgga agaacgacat ggtggaccag atgcacgagg 300

acgtgatctc cctgtgggac cagtccctga agccctgcgt gaagctgacc ccgctgtgcg 360

tgaccctgaa ctgcaccgac gccaccgcgt ccaacgcaac cgcgagcaac gccacggcgt 420

cgaactcctc catcatcgag gagatgaaga actgctcctt caacatcacg acggagctgc 480

gcgacaagcg cgagaagaag aacgccctgt tctacaagct ggacatcgtg cagctggacg 540

gcaactcctc gcagtacagg ctgatcaact gcaacacctc cgccatcacg caggcgtgcc 600

ccaaggtgtc cttcgacccc atccccatcc actactgcgc ccccgccggc tacgccatcc 660

tgaagtgcaa caacaagacc ttcaacggca ccggcccgtg caacaacgtg tccaccgtgc 720

agtgcacgca cgggatcaag cccgtggtgt ccacgcagct gctcctgaac gggtcgctgg 780

ccgagggcga gatcatcatc cggtccgaga acatcacgga caacgggaag accatcatcg 840

tgcacctgaa cgagtccgtg aagatcgagt gcacccgccc gtcgaacaac acgcgcacct 900

ccatccggat cggccctggc caggccttct acgccaccgg ccaggtgatc ggcgacatcc 960

gcgaggcgca ctgcaacatc tcggagtcca agtggaacga gaccctgcag cgcgtgtcca 1020

agaagctgaa ggagtacttc ccccacaaga acatcacctt ccagccgtcg tccggcggcg 1080

acctcgagat caccacgcac tccttcaact gcggtggcga gttcttctac tgcaacacgt 1140

cgtcgctgtt caaccgcacc tacatggcca actccaccga gaccaactcc acgcgcatca 1200

tcacgatcca ctgccgcatc aagcagatca tcaacatgtg gcaggaggtg ggccgcgcca 1260

tgtacgcacc gcccatcgcc ggcaacatca cctgcatctc caacatcacc ggcctcctgc 1320

tgacccgcga cggcggcaac aacaacacgg agaccttcag gccaggcgga ggcaacatga 1380

aggacaactg gcgctccgag ctgtacaagt acaaggtggt ggaggtgaag cccctgggcg 1440

tggcacccac caacgcccgc gagcgcgtcg tggagcgcga gaaggagtga tagtaagaat 1500

tcgggacctg gatcc 1515

<210> SEQ ID NO 216

<211> LENGTH: 846

<212> TYPE: PRT

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polypeptide

<400> SEQUENCE: 216

Met Arg Val Met Gly Ile Gln Arg Asn Tyr Pro Gln Trp Trp Ile Trp

1 5 10 15

Ser Met Leu Gly Phe Trp Met Leu Met Ile Cys Asn Gly Met Trp Val

20 25 30

Thr Val Tyr Tyr Gly Val Pro Val Trp Lys Glu Ala Lys Thr Thr Leu

35 40 45

Phe Cys Ala Ser Asp Ala Lys Ala Tyr Glu Lys Glu Val His Asn Val

50 55 60

Trp Ala Thr His Ala Cys Val Pro Thr Asp Pro Asn Pro Gln Glu Met

65 70 75 80

Val Leu Lys Asn Val Thr Glu Asn Phe Asn Met Trp Lys Asn Asp Met

85 90 95

Val Asp Gln Met His Glu Asp Val Ile Ser Leu Trp Asp Gln Ser Leu

100 105 110

Lys Pro Cys Val Lys Leu Thr Pro Leu Cys Val Thr Leu Asn Cys Thr

115 120 125

Asn Ala Thr Ala Ser Asn Ser Ser Ile Ile Glu Gly Met Lys Asn Cys

130 135 140

Ser Phe Asn Ile Thr Thr Glu Leu Arg Asp Lys Arg Glu Lys Lys Asn

145 150 155 160

Ala Leu Phe Tyr Lys Leu Asp Ile Val Gln Leu Asp Gly Asn Ser Ser

165 170 175

Gln Tyr Arg Leu Ile Asn Cys Asn Thr Ser Val Ile Thr Gln Ala Cys

180 185 190

Pro Lys Val Ser Phe Asp Pro Ile Pro Ile His Tyr Cys Ala Pro Ala

195 200 205

Gly Tyr Ala Ile Leu Lys Cys Asn Asn Lys Thr Phe Thr Gly Thr Gly

210 215 220

Pro Cys Asn Asn Val Ser Thr Val Gln Cys Thr His Gly Ile Lys Pro

225 230 235 240

Val Val Ser Thr Gln Leu Leu Leu Asn Gly Ser Leu Ala Glu Gly Glu

245 250 255

Ile Ile Ile Arg Ser Glu Asn Ile Thr Asn Asn Val Lys Thr Ile Ile

260 265 270

Val His Leu Asn Glu Ser Val Lys Ile Glu Cys Thr Arg Pro Asn Asn

275 280 285

Lys Thr Arg Thr Ser Ile Arg Ile Gly Pro Gly Gln Ala Phe Tyr Ala

290 295 300

Thr Gly Gln Val Ile Gly Asp Ile Arg Glu Ala Tyr Cys Asn Ile Asn

305 310 315 320

Glu Ser Lys Trp Asn Glu Thr Leu Gln Arg Val Ser Lys Lys Leu Lys

325 330 335

Glu Tyr Phe Pro His Lys Asn Ile Thr Phe Gln Pro Ser Ser Gly Gly

340 345 350

Asp Leu Glu Ile Thr Thr His Ser Phe Asn Cys Gly Gly Glu Phe Phe

355 360 365

Tyr Cys Asn Thr Ser Ser Leu Phe Asn Arg Thr Tyr Met Ala Asn Ser

370 375 380

Thr Asp Met Ala Asn Ser Thr Glu Thr Asn Ser Thr Arg Thr Ile Thr

385 390 395 400

Ile His Cys Arg Ile Lys Gln Ile Ile Asn Met Trp Gln Glu Val Gly

405 410 415

Arg Ala Met Tyr Ala Pro Pro Ile Ala Gly Asn Ile Thr Cys Ile Ser

420 425 430

Asn Ile Thr Gly Leu Leu Leu Thr Arg Asp Gly Gly Lys Asn Asn Thr

435 440 445

Glu Thr Phe Arg Pro Gly Gly Gly Asn Met Lys Asp Asn Trp Arg Ser

450 455 460

Glu Leu Tyr Lys Tyr Lys Val Val Glu Val Lys Pro Leu Gly Val Ala

465 470 475 480

Pro Thr Asn Ala Arg Arg Arg Val Val Glu Arg Glu Lys Arg Ala Val

485 490 495

Gly Met Gly Ala Val Phe Leu Gly Phe Leu Gly Ala Ala Gly Ser Thr

500 505 510

Met Gly Ala Ala Ser Ile Thr Leu Thr Val Gln Ala Arg Gln Leu Leu

515 520 525

Ser Gly Ile Val Gln Gln Gln Ser Asn Leu Leu Lys Ala Ile Glu Ala

530 535 540

Gln Gln His Met Leu Lys Leu Thr Val Trp Gly Ile Lys Gln Leu Gln

545 550 555 560

Ala Arg Val Leu Ala Leu Glu Arg Tyr Leu Lys Asp Gln Gln Leu Leu

565 570 575

Gly Met Trp Gly Cys Ser Gly Lys Leu Ile Cys Thr Thr Asn Val Tyr

580 585 590

Trp Asn Ser Ser Trp Ser Asn Lys Thr Tyr Gly Asp Ile Trp Asp Asn

595 600 605

Met Thr Trp Met Gln Trp Glu Arg Glu Ile Ser Asn Tyr Thr Glu Ile

610 615 620

Ile Tyr Glu Leu Leu Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu

625 630 635 640

Gln Asp Leu Leu Ala Leu Asp Arg Trp Asn Ser Leu Trp Asn Trp Phe

645 650 655

Asn Ile Thr Asn Trp Leu Trp Tyr Ile Lys Ile Phe Ile Met Ile Val

660 665 670

Gly Gly Leu Ile Gly Leu Arg Ile Ile Phe Ala Val Leu Ser Leu Val

675 680 685

Asn Arg Val Arg Gln Gly Tyr Ser Pro Leu Ser Leu Gln Thr Leu Ile

690 695 700

Pro Ser Pro Arg Gly Pro Asp Arg Pro Gly Gly Ile Glu Glu Glu Gly

705 710 715 720

Gly Glu Gln Asp Arg Asn Arg Ser Thr Arg Leu Val Ser Gly Phe Leu

725 730 735

Ala Leu Val Trp Asp Asp Leu Arg Ser Leu Cys Leu Phe Ile Tyr His

740 745 750

Arg Leu Arg Asp Phe Ile Leu Ile Ala Ala Arg Ala Gly Glu Leu Leu

755 760 765

Gly Arg Ser Ser Leu Lys Gly Leu Arg Arg Gly Trp Glu Ala Leu Lys

770 775 780

Tyr Leu Gly Ser Leu Val Gln Tyr Trp Gly Leu Glu Leu Lys Arg Ser

785 790 795 800

Ala Ile Ser Leu Leu Asp Thr Leu Ala Ile Ala Val Gly Glu Gly Thr

805 810 815

Asp Arg Ile Leu Glu Phe Val Leu Gly Ile Cys Arg Ala Ile Arg Asn

820 825 830

Ile Pro Thr Arg Ile Arg Gln Gly Phe Glu Thr Ala Leu Leu

835 840 845

<210> SEQ ID NO 217

<211> LENGTH: 846

<212> TYPE: PRT

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polypeptide

<400> SEQUENCE: 217

Met Arg Val Met Gly Ile Gln Arg Asn Tyr Pro Gln Trp Trp Ile Trp

1 5 10 15

Ser Met Leu Gly Phe Trp Met Leu Met Ile Cys Asn Gly Met Trp Val

20 25 30

Thr Val Tyr Tyr Gly Val Pro Val Trp Lys Glu Ala Lys Thr Thr Leu

35 40 45

Phe Cys Ala Ser Asp Ala Lys Ala Tyr Glu Lys Glu Val His Asn Val

50 55 60

Trp Ala Thr His Ala Cys Val Pro Thr Asp Pro Asn Pro Gln Glu Met

65 70 75 80

Val Leu Lys Asn Val Thr Glu Asn Phe Asn Met Trp Lys Asn Asp Met

85 90 95

Val Asp Gln Met His Glu Asp Val Ile Ser Leu Trp Asp Gln Ser Leu

100 105 110

Lys Pro Cys Val Lys Leu Thr Pro Leu Cys Val Thr Leu Asn Cys Thr

115 120 125

Asn Ala Thr Ala Ser Asn Ser Ser Ile Ile Glu Gly Met Lys Asn Cys

130 135 140

Ser Phe Asn Ile Thr Thr Glu Leu Arg Asp Lys Arg Glu Lys Lys Asn

145 150 155 160

Ala Leu Phe Tyr Lys Leu Asp Ile Val Gln Leu Asp Gly Asn Ser Ser

165 170 175

Gln Tyr Arg Leu Ile Asn Cys Asn Thr Ser Val Ile Thr Gln Ala Cys

180 185 190

Pro Lys Val Ser Phe Asp Pro Ile Pro Ile His Tyr Cys Ala Pro Ala

195 200 205

Gly Tyr Ala Ile Leu Lys Cys Asn Asn Lys Thr Phe Thr Gly Thr Gly

210 215 220

Pro Cys Asn Asn Val Ser Thr Val Gln Cys Thr His Gly Ile Lys Pro

225 230 235 240

Val Val Ser Thr Gln Leu Leu Leu Asn Gly Ser Leu Ala Glu Gly Glu

245 250 255

Ile Ile Ile Arg Ser Glu Asn Ile Thr Asn Asn Val Lys Thr Ile Ile

260 265 270

Val His Leu Asn Glu Ser Val Lys Ile Glu Cys Thr Arg Pro Asn Asn

275 280 285

Lys Thr Arg Thr Ser Ile Arg Ile Gly Pro Gly Gln Ala Phe Tyr Ala

290 295 300

Thr Gly Gln Val Ile Gly Asp Ile Arg Glu Ala Tyr Cys Asn Ile Asn

305 310 315 320

Glu Ser Lys Trp Asn Glu Thr Leu Gln Arg Val Ser Lys Lys Leu Lys

325 330 335

Glu Tyr Phe Pro His Lys Asn Ile Thr Phe Gln Pro Ser Ser Gly Gly

340 345 350

Asp Leu Glu Ile Thr Thr His Ser Phe Asn Cys Gly Gly Glu Phe Phe

355 360 365

Tyr Cys Asn Thr Ser Ser Leu Phe Asn Arg Thr Tyr Met Ala Asn Ser

370 375 380

Thr Asp Met Ala Asn Ser Thr Glu Thr Asn Ser Thr Arg Thr Ile Thr

385 390 395 400

Ile His Cys Arg Ile Lys Gln Ile Ile Asn Met Trp Gln Glu Val Gly

405 410 415

Arg Ala Met Tyr Ala Pro Pro Ile Ala Gly Asn Ile Thr Cys Ile Ser

420 425 430

Asn Ile Thr Gly Leu Leu Leu Thr Arg Asp Gly Gly Lys Asn Asn Thr

435 440 445

Glu Thr Phe Arg Pro Gly Gly Gly Asn Met Lys Asp Asn Trp Arg Ser

450 455 460

Glu Leu Tyr Lys Tyr Lys Val Val Glu Val Lys Pro Leu Gly Val Ala

465 470 475 480

Pro Thr Asn Ala Arg Arg Arg Val Val Glu Arg Glu Lys Arg Ala Val

485 490 495

Gly Met Gly Ala Val Phe Leu Gly Phe Leu Gly Ala Ala Gly Ser Thr

500 505 510

Met Gly Ala Ala Ser Ile Thr Leu Thr Val Gln Ala Arg Gln Leu Leu

515 520 525

Ser Gly Ile Val Gln Gln Gln Ser Asn Leu Leu Lys Ala Ile Glu Ala

530 535 540

Gln Gln His Met Leu Lys Leu Thr Val Trp Gly Ile Lys Gln Leu Gln

545 550 555 560

Ala Arg Val Leu Ala Leu Glu Arg Tyr Leu Lys Asp Gln Gln Leu Leu

565 570 575

Gly Met Trp Gly Cys Ser Gly Lys Leu Ile Cys Thr Thr Asn Val Tyr

580 585 590

Trp Asn Ser Ser Trp Ser Asn Lys Thr Tyr Gly Asp Ile Trp Asp Asn

595 600 605

Met Thr Trp Met Gln Trp Glu Arg Glu Ile Ser Asn Tyr Thr Glu Ile

610 615 620

Ile Tyr Glu Leu Leu Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu

625 630 635 640

Gln Asp Leu Leu Ala Leu Asp Arg Trp Asn Ser Leu Trp Asn Trp Phe

645 650 655

Asn Ile Thr Asn Trp Leu Gly Tyr Ile Lys Ile Phe Ile Met Ile Val

660 665 670

Gly Gly Leu Ile Gly Leu Arg Ile Ile Phe Ala Val Leu Ser Leu Val

675 680 685

Asn Arg Val Arg Gln Gly Tyr Ser Pro Leu Ser Leu Gln Thr Leu Ile

690 695 700

Pro Ser Pro Arg Gly Pro Asp Arg Pro Gly Gly Ile Glu Glu Glu Gly

705 710 715 720

Gly Glu Gln Asp Arg Asn Arg Ser Thr Arg Leu Val Ser Gly Phe Leu

725 730 735

Ala Leu Val Trp Asp Asp Leu Arg Ser Leu Cys Leu Phe Ile Tyr His

740 745 750

Arg Leu Arg Asp Phe Ile Leu Ile Ala Ala Arg Ala Gly Glu Leu Leu

755 760 765

Gly Arg Ser Ser Leu Lys Gly Leu Arg Arg Gly Trp Glu Ala Leu Lys

770 775 780

Tyr Leu Gly Ser Leu Val Gln Tyr Trp Gly Leu Glu Leu Lys Arg Ser

785 790 795 800

Ala Ile Ser Leu Leu Asp Thr Leu Ala Ile Ala Val Gly Glu Gly Thr

805 810 815

Asp Arg Ile Leu Glu Phe Val Leu Gly Ile Cys Arg Ala Ile Arg Asn

820 825 830

Ile Pro Thr Arg Ile Arg Gln Gly Phe Glu Thr Ala Leu Leu

835 840 845

<210> SEQ ID NO 218

<211> LENGTH: 846

<212> TYPE: PRT

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polypeptide

<400> SEQUENCE: 218

Met Arg Val Met Gly Ile Gln Arg Asn Tyr Pro Gln Trp Trp Ile Trp

1 5 10 15

Ser Met Leu Gly Phe Trp Met Leu Met Ile Cys Asn Gly Met Trp Val

20 25 30

Thr Val Tyr Tyr Gly Val Pro Val Trp Lys Glu Ala Lys Thr Thr Leu

35 40 45

Phe Cys Ala Ser Asp Ala Lys Ala Tyr Glu Lys Glu Val His Asn Val

50 55 60

Trp Ala Thr His Ala Cys Val Pro Thr Asp Pro Asn Pro Gln Glu Met

65 70 75 80

Val Leu Lys Asn Val Thr Glu Asn Phe Asn Met Trp Lys Asn Asp Met

85 90 95

Val Asp Gln Met His Glu Asp Val Ile Ser Leu Trp Asp Gln Ser Leu

100 105 110

Lys Pro Cys Val Lys Leu Thr Pro Leu Cys Val Thr Leu Asn Cys Thr

115 120 125

Asn Ala Thr Ala Ser Asn Ser Ser Ile Ile Glu Gly Met Lys Asn Cys

130 135 140

Ser Phe Asn Ile Thr Thr Glu Leu Arg Asp Lys Arg Glu Lys Lys Asn

145 150 155 160

Ala Leu Phe Tyr Lys Leu Asp Ile Val Gln Leu Asp Gly Asn Ser Ser

165 170 175

Gln Tyr Arg Leu Ile Asn Cys Asn Thr Ser Val Ile Thr Gln Ala Cys

180 185 190

Pro Lys Val Ser Phe Asp Pro Ile Pro Ile His Tyr Cys Ala Pro Ala

195 200 205

Gly Tyr Ala Ile Leu Lys Cys Asn Asn Lys Thr Phe Thr Gly Thr Gly

210 215 220

Pro Cys Asn Asn Val Ser Thr Val Gln Cys Thr His Gly Ile Lys Pro

225 230 235 240

Val Val Ser Thr Gln Leu Leu Leu Asn Gly Ser Leu Ala Glu Gly Glu

245 250 255

Ile Ile Ile Arg Ser Glu Asn Ile Thr Asn Asn Val Lys Thr Ile Ile

260 265 270

Val His Leu Asn Glu Ser Val Lys Ile Glu Cys Thr Arg Pro Asn Asn

275 280 285

Lys Thr Arg Thr Ser Ile Arg Ile Gly Pro Gly Gln Ala Phe Tyr Ala

290 295 300

Thr Gly Gln Val Ile Gly Asp Ile Arg Glu Ala Tyr Cys Asn Ile Asn

305 310 315 320

Glu Ser Lys Trp Asn Glu Thr Leu Gln Arg Val Ser Lys Lys Leu Lys

325 330 335

Glu Tyr Phe Pro His Lys Asn Ile Thr Phe Gln Pro Ser Ser Gly Gly

340 345 350

Asp Leu Glu Ile Thr Thr His Ser Phe Asn Cys Gly Gly Glu Phe Phe

355 360 365

Tyr Cys Asn Thr Ser Ser Leu Phe Asn Arg Thr Tyr Met Ala Asn Ser

370 375 380

Thr Asp Met Ala Asn Ser Thr Glu Thr Asn Ser Thr Arg Thr Ile Thr

385 390 395 400

Ile His Cys Arg Ile Lys Gln Ile Ile Asn Met Trp Gln Glu Val Gly

405 410 415

Arg Ala Met Tyr Ala Pro Pro Ile Ala Gly Asn Ile Thr Cys Ile Ser

420 425 430

Asn Ile Thr Gly Leu Leu Leu Thr Arg Asp Gly Gly Lys Asn Asn Thr

435 440 445

Glu Thr Phe Arg Pro Gly Gly Gly Asn Met Lys Asp Asn Trp Arg Ser

450 455 460

Glu Leu Tyr Lys Tyr Lys Val Val Glu Val Lys Pro Leu Gly Val Ala

465 470 475 480

Pro Thr Asn Val Arg Arg Arg Val Val Glu Arg Glu Lys Arg Ala Val

485 490 495

Gly Met Gly Ala Val Phe Leu Gly Phe Leu Gly Ala Ala Gly Ser Thr

500 505 510

Met Gly Ala Ala Ser Ile Thr Leu Thr Val Gln Ala Arg Gln Leu Leu

515 520 525

Ser Gly Ile Val Gln Gln Gln Ser Asn Leu Leu Lys Ala Ile Glu Ala

530 535 540

Gln Gln His Met Leu Lys Leu Thr Val Trp Gly Ile Lys Gln Leu Gln

545 550 555 560

Ala Arg Val Leu Ala Leu Glu Arg Tyr Leu Lys Asp Gln Gln Leu Leu

565 570 575

Gly Met Trp Gly Cys Ser Gly Lys Leu Ile Cys Thr Thr Asn Val Tyr

580 585 590

Trp Asn Ser Ser Trp Ser Asn Lys Thr Tyr Gly Asp Ile Trp Asp Asn

595 600 605

Met Thr Trp Met Gln Trp Glu Arg Glu Ile Ser Asn Tyr Thr Glu Ile

610 615 620

Ile Tyr Glu Leu Leu Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu

625 630 635 640

Gln Asp Leu Leu Ala Leu Asp Arg Trp Asn Ser Leu Trp Asn Trp Phe

645 650 655

Asn Ile Thr Asn Trp Leu Trp Tyr Ile Lys Ile Phe Ile Met Ile Val

660 665 670

Gly Gly Leu Ile Gly Leu Arg Ile Ile Phe Ala Val Leu Ser Leu Val

675 680 685

Asn Arg Val Arg Gln Gly Tyr Ser Pro Leu Ser Leu Gln Thr Leu Ile

690 695 700

Pro Ser Pro Arg Gly Pro Asp Arg Pro Gly Gly Ile Glu Glu Glu Gly

705 710 715 720

Gly Glu Gln Asp Arg Asn Arg Ser Thr Arg Leu Val Ser Gly Phe Leu

725 730 735

Ala Leu Val Trp Asp Asp Leu Arg Ser Leu Cys Leu Phe Ile Tyr His

740 745 750

Arg Leu Arg Asp Phe Ile Leu Ile Ala Ala Arg Ala Gly Glu Leu Leu

755 760 765

Gly Arg Ser Ser Leu Lys Gly Leu Arg Arg Gly Trp Glu Ala Leu Lys

770 775 780

Tyr Leu Gly Ser Leu Val Gln Tyr Trp Gly Leu Glu Leu Lys Arg Ser

785 790 795 800

Ala Ile Ser Leu Leu Asp Thr Leu Ala Ile Ala Val Gly Glu Gly Thr

805 810 815

Asp Arg Ile Leu Glu Phe Val Leu Gly Ile Cys Arg Ala Ile Arg Asn

820 825 830

Ile Pro Thr Arg Ile Arg Gln Gly Phe Glu Thr Ala Leu Leu

835 840 845

<210> SEQ ID NO 219

<211> LENGTH: 846

<212> TYPE: PRT

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polypeptide

<400> SEQUENCE: 219

Met Arg Val Met Gly Ile Gln Arg Asn Tyr Pro Gln Trp Trp Ile Trp

1 5 10 15

Ser Met Leu Gly Phe Trp Met Leu Met Ile Cys Asn Gly Met Trp Val

20 25 30

Thr Val Tyr Tyr Gly Val Pro Val Trp Lys Glu Ala Lys Thr Thr Leu

35 40 45

Phe Cys Ala Ser Asp Ala Lys Ala Tyr Glu Lys Glu Val His Asn Val

50 55 60

Trp Ala Thr His Ala Cys Val Pro Thr Asp Pro Asn Pro Gln Glu Met

65 70 75 80

Val Leu Lys Asn Val Thr Glu Asn Phe Asn Met Trp Lys Asn Asp Met

85 90 95

Val Asp Gln Met His Glu Asp Val Ile Ser Leu Trp Asp Gln Ser Leu

100 105 110

Lys Pro Cys Val Lys Leu Thr Pro Leu Cys Val Thr Leu Asn Cys Thr

115 120 125

Asn Ala Thr Ala Ser Asn Ser Ser Ile Ile Glu Gly Met Lys Asn Cys

130 135 140

Ser Phe Asn Ile Thr Thr Glu Leu Arg Asp Lys Arg Glu Lys Lys Asn

145 150 155 160

Ala Leu Phe Tyr Lys Leu Asp Ile Val Gln Leu Asp Gly Asn Ser Ser

165 170 175

Gln Tyr Arg Leu Ile Asn Cys Asn Thr Ser Val Ile Thr Gln Ala Cys

180 185 190

Pro Lys Val Ser Phe Asp Pro Ile Pro Ile His Tyr Cys Ala Pro Ala

195 200 205

Gly Tyr Ala Ile Leu Lys Cys Asn Asn Lys Thr Phe Thr Gly Thr Gly

210 215 220

Pro Cys Asn Asn Val Ser Thr Val Gln Cys Thr His Gly Ile Lys Pro

225 230 235 240

Val Val Ser Thr Gln Leu Leu Leu Asn Gly Ser Leu Ala Glu Gly Glu

245 250 255

Ile Ile Ile Arg Ser Glu Asn Ile Thr Lys Asn Val Lys Thr Ile Ile

260 265 270

Val His Leu Asn Glu Ser Val Lys Ile Glu Cys Thr Arg Pro Asn Asn

275 280 285

Lys Thr Arg Thr Ser Ile Arg Ile Gly Pro Gly Gln Ala Phe Tyr Ala

290 295 300

Thr Gly Gln Val Ile Gly Asp Ile Arg Glu Ala Tyr Cys Asn Ile Asn

305 310 315 320

Glu Ser Lys Trp Asn Glu Thr Leu Gln Arg Val Ser Lys Lys Leu Lys

325 330 335

Glu Tyr Phe Pro His Lys Asn Ile Thr Phe Gln Pro Ser Ser Gly Gly

340 345 350

Asp Leu Glu Ile Thr Thr His Ser Phe Asn Cys Gly Gly Glu Phe Phe

355 360 365

Tyr Cys Asn Thr Ser Ser Leu Phe Asn Arg Thr Tyr Met Ala Asn Ser

370 375 380

Thr Asp Met Ala Asn Ser Thr Glu Thr Asn Ser Thr Arg Thr Ile Thr

385 390 395 400

Ile His Cys Arg Ile Lys Gln Ile Ile Asn Met Trp Gln Glu Val Gly

405 410 415

Arg Ala Met Tyr Ala Pro Pro Ile Ala Gly Asn Ile Thr Cys Ile Ser

420 425 430

Asn Ile Thr Gly Leu Leu Leu Thr Arg Asp Gly Gly Lys Asn Asn Thr

435 440 445

Glu Thr Phe Arg Pro Gly Gly Gly Asn Met Lys Asp Asn Trp Arg Ser

450 455 460

Glu Leu Tyr Lys Tyr Lys Val Val Glu Val Lys Pro Leu Gly Val Ala

465 470 475 480

Pro Thr Asn Ala Arg Arg Arg Val Val Glu Arg Glu Lys Arg Ala Val

485 490 495

Gly Met Gly Ala Val Phe Leu Gly Phe Leu Gly Ala Ala Gly Ser Thr

500 505 510

Met Gly Ala Ala Ser Ile Thr Leu Thr Val Gln Ala Arg Gln Leu Leu

515 520 525

Ser Gly Ile Val Gln Gln Gln Ser Asn Leu Leu Lys Ala Ile Glu Ala

530 535 540

Gln Gln His Met Leu Lys Leu Thr Val Trp Gly Ile Lys Gln Leu Gln

545 550 555 560

Ala Arg Val Leu Ala Leu Glu Arg Tyr Leu Lys Asp Gln Gln Leu Leu

565 570 575

Gly Met Trp Gly Cys Ser Gly Lys Leu Ile Cys Thr Thr Asn Val Tyr

580 585 590

Trp Asn Ser Ser Trp Ser Asn Lys Thr Tyr Gly Asp Ile Trp Asp Asn

595 600 605

Met Thr Trp Met Gln Trp Glu Arg Glu Ile Ser Asn Tyr Thr Glu Ile

610 615 620

Ile Tyr Glu Leu Leu Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu

625 630 635 640

Gln Asp Leu Leu Ala Leu Asp Arg Trp Asn Ser Leu Trp Asn Trp Phe

645 650 655

Asn Ile Thr Asn Trp Leu Trp Tyr Ile Lys Ile Phe Ile Met Ile Val

660 665 670

Gly Gly Leu Ile Gly Leu Arg Ile Ile Phe Ala Val Leu Ser Leu Val

675 680 685

Asn Arg Val Arg Gln Gly Tyr Ser Pro Leu Ser Leu Gln Thr Leu Ile

690 695 700

Pro Ser Pro Arg Gly Pro Asp Arg Pro Gly Gly Ile Glu Glu Glu Gly

705 710 715 720

Gly Glu Gln Asp Arg Asn Arg Ser Thr Arg Leu Val Ser Gly Phe Leu

725 730 735

Ala Leu Val Trp Asp Asp Leu Arg Ser Leu Cys Leu Phe Ile Tyr His

740 745 750

Arg Leu Arg Asp Phe Ile Leu Ile Ala Ala Arg Ala Gly Glu Leu Leu

755 760 765

Gly Arg Ser Ser Leu Lys Gly Leu Arg Arg Gly Trp Glu Ala Leu Lys

770 775 780

Tyr Leu Gly Ser Leu Val Gln Tyr Trp Gly Leu Glu Leu Lys Arg Ser

785 790 795 800

Ala Ile Ser Leu Leu Asp Thr Leu Ala Ile Ala Val Gly Glu Gly Thr

805 810 815

Asp Arg Ile Leu Glu Phe Val Leu Gly Ile Cys Arg Ala Ile Arg Asn

820 825 830

Ile Pro Thr Arg Ile Arg Gln Gly Phe Glu Thr Ala Leu Leu

835 840 845

<210> SEQ ID NO 220

<211> LENGTH: 846

<212> TYPE: PRT

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polypeptide

<400> SEQUENCE: 220

Met Arg Val Met Gly Ile Gln Arg Asn Tyr Pro Gln Trp Trp Ile Trp

1 5 10 15

Ser Met Leu Gly Phe Trp Met Leu Met Ile Cys Asn Gly Met Trp Val

20 25 30

Thr Val Tyr Tyr Gly Val Pro Val Trp Lys Glu Ala Lys Thr Thr Leu

35 40 45

Phe Cys Ala Ser Asp Ala Lys Ala Tyr Glu Lys Glu Val His Asn Val

50 55 60

Trp Ala Thr His Ala Cys Val Pro Thr Asp Pro Asn Pro Gln Glu Met

65 70 75 80

Val Leu Lys Asn Val Thr Glu Asn Phe Asn Met Trp Lys Asn Asp Met

85 90 95

Val Asp Gln Met His Glu Asp Val Ile Ser Leu Trp Asp Gln Ser Leu

100 105 110

Lys Pro Cys Val Lys Leu Thr Pro Leu Cys Val Thr Leu Asn Cys Thr

115 120 125

Asn Ala Thr Ala Ser Asn Ser Ser Ile Ile Glu Gly Met Lys Asn Cys

130 135 140

Ser Phe Asn Ile Thr Thr Glu Leu Arg Asp Lys Arg Glu Lys Lys Asn

145 150 155 160

Ala Leu Phe Tyr Lys Leu Asp Ile Val Gln Leu Asp Gly Asn Ser Ser

165 170 175

Gln Tyr Arg Leu Ile Asn Cys Asn Thr Ser Val Ile Thr Gln Ala Cys

180 185 190

Pro Lys Val Ser Phe Asp Pro Ile Pro Ile His Tyr Cys Ala Pro Ala

195 200 205

Gly Tyr Val Ile Leu Lys Cys Asn Asn Lys Thr Phe Thr Gly Thr Gly

210 215 220

Pro Cys Asn Asn Val Ser Thr Val Gln Cys Thr His Gly Ile Lys Pro

225 230 235 240

Val Val Ser Thr Gln Leu Leu Leu Asn Gly Ser Leu Ala Glu Gly Glu

245 250 255

Ile Ile Ile Arg Ser Glu Asn Ile Thr Asn Asn Val Lys Thr Ile Ile

260 265 270

Val His Leu Asn Glu Ser Val Lys Ile Glu Cys Thr Arg Pro Asn Asn

275 280 285

Lys Thr Arg Thr Ser Ile Arg Ile Gly Pro Gly Gln Ala Phe Tyr Ala

290 295 300

Thr Gly Gln Val Ile Gly Asp Ile Arg Glu Ala Tyr Cys Asn Ile Asn

305 310 315 320

Glu Ser Lys Trp Asn Glu Thr Leu Gln Arg Val Ser Lys Lys Leu Lys

325 330 335

Glu Tyr Phe Pro His Lys Asn Ile Thr Phe Gln Pro Ser Ser Gly Gly

340 345 350

Asp Leu Glu Ile Thr Thr His Ser Phe Asn Cys Gly Gly Glu Phe Phe

355 360 365

Tyr Cys Asn Thr Ser Ser Leu Phe Asn Arg Thr Tyr Met Ala Asn Ser

370 375 380

Thr Asp Met Ala Asn Ser Thr Glu Thr Asn Ser Thr Arg Thr Ile Lys

385 390 395 400

Ile His Cys Arg Ile Lys Gln Ile Ile Asn Met Trp Gln Glu Val Gly

405 410 415

Arg Ala Met Tyr Ala Pro Pro Ile Ala Gly Asn Ile Thr Cys Ile Ser

420 425 430

Asn Ile Thr Gly Leu Leu Leu Thr Arg Asp Gly Gly Lys Asn Asn Thr

435 440 445

Glu Thr Phe Arg Pro Gly Gly Gly Asn Met Lys Asp Asn Trp Arg Ser

450 455 460

Glu Leu Tyr Lys Tyr Lys Val Val Glu Val Lys Pro Leu Gly Val Ala

465 470 475 480

Pro Thr Asn Ala Arg Arg Arg Val Val Glu Arg Glu Lys Arg Ala Val

485 490 495

Gly Met Gly Ala Val Phe Leu Gly Phe Leu Gly Ala Ala Gly Ser Thr

500 505 510

Met Gly Ala Ala Ser Ile Thr Leu Thr Val Gln Ala Arg Gln Leu Leu

515 520 525

Ser Gly Ile Val Gln Gln Gln Ser Asn Leu Leu Lys Ala Ile Glu Ala

530 535 540

Gln Gln His Met Leu Lys Leu Thr Val Trp Gly Ile Lys Gln Leu Gln

545 550 555 560

Ala Arg Val Leu Ala Leu Glu Arg Tyr Leu Lys Asp Gln Gln Leu Leu

565 570 575

Gly Met Trp Gly Cys Ser Gly Lys Leu Ile Cys Thr Thr Asn Val Tyr

580 585 590

Trp Asn Ser Ser Trp Ser Asn Lys Thr Tyr Gly Asp Ile Trp Asp Asn

595 600 605

Met Thr Trp Met Gln Trp Glu Arg Glu Ile Ser Asn Tyr Thr Glu Ile

610 615 620

Ile Tyr Glu Leu Leu Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu

625 630 635 640

Gln Asp Leu Leu Ala Leu Asp Arg Trp Asn Ser Leu Trp Asn Trp Phe

645 650 655

Asn Ile Thr Asn Trp Leu Trp Tyr Ile Lys Ile Phe Ile Met Ile Val

660 665 670

Gly Gly Leu Ile Gly Leu Arg Ile Ile Phe Ala Val Leu Ser Leu Val

675 680 685

Asn Arg Val Arg Gln Gly Tyr Ser Pro Leu Ser Leu Gln Thr Leu Ile

690 695 700

Pro Ser Pro Arg Gly Pro Asp Arg Pro Gly Gly Ile Glu Glu Glu Gly

705 710 715 720

Gly Glu Gln Asp Arg Asn Arg Ser Thr Arg Leu Val Ser Gly Phe Leu

725 730 735

Ala Leu Val Trp Asp Asp Leu Arg Ser Leu Cys Leu Phe Ile Tyr His

740 745 750

Arg Leu Arg Asp Phe Ile Leu Ile Ala Ala Arg Ala Gly Glu Leu Leu

755 760 765

Gly Arg Ser Ser Leu Lys Gly Leu Arg Arg Gly Trp Glu Ala Leu Lys

770 775 780

Tyr Leu Gly Ser Leu Val Gln Tyr Trp Gly Leu Glu Leu Lys Arg Ser

785 790 795 800

Ala Ile Ser Leu Leu Asp Thr Leu Ala Ile Ala Val Gly Glu Gly Thr

805 810 815

Asp Arg Ile Leu Lys Phe Val Leu Gly Ile Cys Arg Ala Ile Arg Asn

820 825 830

Ile Pro Thr Arg Ile Arg Gln Gly Phe Glu Thr Ala Leu Leu

835 840 845

<210> SEQ ID NO 221

<211> LENGTH: 846

<212> TYPE: PRT

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polypeptide

<400> SEQUENCE: 221

Met Arg Val Met Gly Ile Gln Arg Asn Tyr Pro Gln Trp Trp Ile Trp

1 5 10 15

Ser Met Leu Gly Phe Trp Met Leu Met Ile Cys Asn Gly Met Trp Val

20 25 30

Thr Val Tyr Tyr Gly Val Pro Val Trp Lys Glu Ala Lys Thr Thr Leu

35 40 45

Phe Cys Ala Ser Asp Ala Lys Ala Tyr Glu Lys Glu Val His Asn Val

50 55 60

Trp Ala Thr His Ala Cys Val Pro Thr Asp Pro Asn Pro Gln Glu Met

65 70 75 80

Val Leu Lys Asn Val Thr Glu Asn Phe Asn Met Trp Lys Asn Asp Met

85 90 95

Val Asp Gln Met His Glu Asp Val Ile Ser Leu Trp Asp Gln Ser Leu

100 105 110

Lys Pro Cys Val Lys Leu Thr Pro Leu Cys Val Thr Leu Asn Cys Thr

115 120 125

Asn Ala Thr Ala Ser Asn Ser Ser Ile Ile Glu Gly Met Lys Asn Cys

130 135 140

Ser Phe Asn Ile Thr Thr Glu Leu Arg Asp Lys Arg Glu Lys Lys Asn

145 150 155 160

Ala Leu Phe Tyr Lys Leu Asp Ile Val Gln Leu Asp Gly Asn Ser Ser

165 170 175

Gln Tyr Arg Leu Ile Asn Cys Asn Thr Ser Val Ile Thr Gln Ala Cys

180 185 190

Pro Lys Val Ser Phe Asp Pro Ile Pro Ile His Tyr Cys Ala Pro Ala

195 200 205

Gly Tyr Ala Ile Leu Lys Cys Asn Asn Lys Thr Phe Thr Gly Thr Gly

210 215 220

Pro Cys Asn Asn Val Ser Thr Val Gln Cys Thr His Gly Ile Lys Pro

225 230 235 240

Val Val Ser Thr Gln Leu Leu Leu Asn Gly Ser Leu Ala Glu Gly Glu

245 250 255

Ile Ile Ile Arg Ser Glu Asn Ile Thr Asn Asn Val Lys Thr Ile Ile

260 265 270

Val His Leu Asn Glu Ser Val Lys Ile Glu Cys Thr Arg Pro Asn Asn

275 280 285

Lys Thr Arg Thr Ser Ile Arg Ile Gly Pro Gly Gln Ala Phe Tyr Ala

290 295 300

Thr Gly Gln Val Ile Gly Asp Ile Arg Glu Ala Tyr Cys Asn Ile Asn

305 310 315 320

Glu Ser Lys Trp Asn Glu Thr Leu Gln Arg Val Ser Lys Lys Leu Lys

325 330 335

Glu Tyr Phe Pro His Lys Asn Ile Thr Phe Gln Pro Ser Ser Gly Gly

340 345 350

Asp Leu Glu Ile Thr Thr His Ser Phe Asn Cys Gly Gly Glu Phe Phe

355 360 365

Tyr Cys Asn Thr Ser Ser Leu Phe Asn Arg Thr Tyr Met Ala Asn Ser

370 375 380

Thr Asp Met Ala Asn Ser Thr Glu Thr Asn Ser Thr Arg Thr Ile Lys

385 390 395 400

Ile His Cys Arg Ile Lys Gln Ile Ile Asn Met Trp Gln Glu Val Gly

405 410 415

Arg Ala Met Tyr Ala Pro Pro Ile Ala Gly Asn Ile Thr Cys Ile Ser

420 425 430

Asn Ile Thr Gly Leu Leu Leu Thr Arg Asp Gly Gly Lys Asn Asn Thr

435 440 445

Glu Thr Phe Arg Pro Gly Gly Gly Asn Met Lys Asp Asn Trp Arg Ser

450 455 460

Glu Leu Tyr Lys Tyr Lys Val Val Glu Val Lys Pro Leu Gly Val Ala

465 470 475 480

Pro Thr Asn Ala Arg Arg Arg Val Val Glu Arg Glu Lys Arg Ala Val

485 490 495

Gly Met Gly Ala Val Phe Leu Gly Phe Leu Gly Ala Ala Gly Ser Thr

500 505 510

Met Gly Ala Ala Ser Ile Thr Leu Thr Val Gln Ala Arg Gln Leu Leu

515 520 525

Ser Gly Ile Val Gln Gln Gln Ser Asn Leu Leu Lys Ala Ile Glu Ala

530 535 540

Gln Gln His Met Leu Lys Leu Thr Val Trp Gly Ile Lys Gln Leu Gln

545 550 555 560

Ala Arg Val Leu Ala Leu Glu Arg Tyr Leu Lys Asp Gln Gln Leu Leu

565 570 575

Gly Met Trp Gly Cys Ser Gly Lys Leu Ile Cys Thr Thr Asn Val Tyr

580 585 590

Trp Asn Ser Ser Trp Ser Asn Lys Thr Tyr Gly Asp Ile Trp Asp Asn

595 600 605

Met Thr Trp Met Gln Trp Glu Arg Glu Ile Ser Asn Tyr Thr Glu Ile

610 615 620

Ile Tyr Glu Leu Leu Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu

625 630 635 640

Gln Asp Leu Leu Ala Leu Asp Arg Trp Asn Ser Leu Trp Asn Trp Phe

645 650 655

Asn Ile Thr Asn Trp Leu Trp Tyr Ile Lys Ile Phe Ile Met Ile Val

660 665 670

Gly Gly Leu Ile Gly Leu Arg Ile Ile Phe Ala Val Leu Ser Leu Val

675 680 685

Asn Arg Val Arg Gln Gly Tyr Ser Pro Leu Ser Leu Gln Thr Leu Ile

690 695 700

Pro Ser Pro Arg Gly Pro Asp Arg Pro Gly Gly Ile Glu Glu Glu Gly

705 710 715 720

Gly Glu Gln Asp Arg Asn Arg Ser Thr Arg Leu Val Ser Gly Phe Leu

725 730 735

Ala Leu Val Trp Asp Asp Leu Arg Ser Leu Cys Leu Phe Ile Tyr His

740 745 750

Arg Leu Arg Asp Phe Ile Leu Ile Ala Ala Arg Ala Gly Glu Leu Leu

755 760 765

Gly Arg Ser Ser Leu Lys Gly Leu Arg Arg Gly Trp Glu Ala Leu Lys

770 775 780

Tyr Leu Gly Ser Leu Val Gln Tyr Trp Gly Leu Glu Leu Lys Arg Ser

785 790 795 800

Ala Ile Ser Leu Leu Asp Thr Leu Ala Ile Ala Val Gly Glu Gly Thr

805 810 815

Asp Arg Ile Leu Lys Phe Val Leu Gly Ile Cys Arg Ala Ile Arg Asn

820 825 830

Ile Pro Thr Arg Ile Arg Gln Gly Phe Glu Thr Ala Leu Leu

835 840 845

<210> SEQ ID NO 222

<211> LENGTH: 846

<212> TYPE: PRT

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polypeptide

<400> SEQUENCE: 222

Met Arg Val Met Gly Ile Gln Arg Asn Tyr Pro Gln Trp Trp Ile Trp

1 5 10 15

Ser Met Leu Gly Phe Trp Met Leu Met Ile Cys Asn Gly Met Trp Val

20 25 30

Thr Val Tyr Tyr Gly Val Pro Val Trp Lys Glu Ala Lys Thr Thr Leu

35 40 45

Phe Cys Ala Ser Asp Ala Lys Ala Tyr Glu Lys Glu Val His Asn Val

50 55 60

Trp Ala Thr His Ala Cys Val Pro Thr Asp Pro Asn Pro Gln Glu Met

65 70 75 80

Val Leu Lys Asn Val Thr Glu Asn Phe Asn Met Trp Lys Asn Asp Met

85 90 95

Val Asp Gln Met His Glu Asp Val Ile Ser Leu Trp Asp Gln Ser Leu

100 105 110

Lys Pro Cys Val Lys Leu Thr Pro Leu Cys Val Thr Leu Asn Cys Thr

115 120 125

Asn Ala Thr Ala Ser Asn Ser Ser Ile Ile Glu Gly Met Lys Asn Cys

130 135 140

Ser Phe Asn Ile Thr Thr Glu Leu Arg Asp Lys Arg Glu Lys Lys Asn

145 150 155 160

Ala Leu Phe Tyr Lys Leu Asp Ile Val Gln Leu Asp Gly Asn Ser Ser

165 170 175

Gln Tyr Arg Leu Ile Asn Cys Asn Thr Ser Val Ile Thr Gln Ala Cys

180 185 190

Pro Lys Val Ser Phe Asp Pro Ile Pro Ile His Tyr Cys Ala Pro Ala

195 200 205

Gly Tyr Ala Ile Leu Lys Cys Asn Asn Lys Thr Phe Thr Gly Thr Gly

210 215 220

Pro Cys Asn Asn Val Ser Thr Val Gln Cys Thr His Gly Ile Lys Pro

225 230 235 240

Val Val Ser Thr Gln Leu Leu Leu Asn Gly Ser Leu Ala Glu Gly Glu

245 250 255

Ile Ile Ile Arg Ser Glu Asn Ile Thr Asn Asn Val Lys Thr Ile Ile

260 265 270

Val His Leu Asn Glu Ser Val Lys Ile Glu Cys Thr Arg Pro Asn Asn

275 280 285

Lys Thr Arg Thr Ser Ile Arg Ile Gly Pro Gly Gln Ala Phe Tyr Ala

290 295 300

Thr Gly Gln Val Ile Gly Asp Ile Arg Glu Ala Tyr Cys Asn Ile Asn

305 310 315 320

Glu Ser Lys Trp Asn Glu Thr Leu Gln Arg Val Ser Lys Lys Leu Lys

325 330 335

Glu Tyr Phe Pro His Lys Asn Ile Thr Phe Gln Pro Ser Ser Gly Gly

340 345 350

Asp Leu Glu Ile Thr Thr His Ser Phe Asn Cys Gly Gly Glu Phe Phe

355 360 365

Tyr Cys Asn Thr Ser Ser Leu Phe Asn Arg Thr Tyr Met Ala Asn Ser

370 375 380

Thr Asp Met Ala Asn Ser Thr Glu Thr Asn Ser Thr Arg Thr Ile Thr

385 390 395 400

Ile Arg Cys Arg Ile Lys Gln Ile Ile Asn Met Trp Gln Glu Val Gly

405 410 415

Arg Ala Met Tyr Ala Pro Pro Ile Ala Gly Asn Ile Thr Cys Ile Ser

420 425 430

Asn Ile Thr Gly Leu Leu Leu Thr Arg Asp Gly Gly Lys Asn Asn Thr

435 440 445

Glu Thr Phe Arg Pro Gly Gly Gly Asn Met Lys Asp Asn Trp Arg Ser

450 455 460

Glu Leu Tyr Lys Tyr Lys Val Val Glu Val Lys Pro Leu Gly Val Ala

465 470 475 480

Pro Thr Asn Ala Arg Arg Arg Val Val Glu Arg Glu Lys Arg Ala Val

485 490 495

Gly Met Gly Ala Val Phe Leu Gly Phe Leu Gly Ala Ala Gly Ser Thr

500 505 510

Met Gly Ala Ala Ser Ile Thr Leu Thr Val Gln Ala Arg Gln Leu Leu

515 520 525

Ser Gly Ile Val Gln Gln Gln Ser Asn Leu Leu Lys Ala Ile Glu Ala

530 535 540

Gln Gln His Met Leu Lys Leu Thr Val Trp Gly Ile Lys Gln Leu Gln

545 550 555 560

Ala Arg Val Leu Ala Leu Glu Arg Tyr Leu Lys Asp Gln Gln Leu Leu

565 570 575

Gly Met Trp Gly Cys Ser Gly Lys Leu Ile Cys Thr Thr Asn Val Tyr

580 585 590

Trp Asn Ser Ser Trp Ser Asn Lys Thr Tyr Gly Asp Ile Trp Asp Asn

595 600 605

Met Thr Trp Met Gln Trp Glu Arg Glu Ile Ser Asn Tyr Thr Glu Ile

610 615 620

Ile Tyr Glu Leu Leu Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu

625 630 635 640

Gln Asp Leu Leu Ala Leu Asp Arg Trp Asn Ser Leu Trp Asn Trp Phe

645 650 655

Asn Ile Thr Asn Trp Leu Trp Tyr Ile Lys Ile Phe Ile Met Ile Val

660 665 670

Gly Gly Leu Ile Gly Leu Arg Ile Ile Phe Ala Val Leu Ser Leu Val

675 680 685

Asn Arg Val Arg Gln Gly Tyr Ser Pro Leu Ser Leu Gln Thr Leu Ile

690 695 700

Pro Ser Pro Arg Gly Pro Asp Arg Pro Gly Gly Ile Glu Glu Glu Gly

705 710 715 720

Gly Glu Gln Asp Arg Asn Arg Ser Thr Arg Leu Val Ser Gly Phe Leu

725 730 735

Ala Leu Val Trp Asp Asp Leu Arg Ser Leu Cys Leu Phe Ile Tyr His

740 745 750

Arg Leu Arg Asp Phe Ile Leu Ile Ala Ala Arg Ala Gly Glu Leu Leu

755 760 765

Gly Arg Ser Ser Leu Lys Gly Leu Arg Arg Gly Trp Glu Ala Leu Lys

770 775 780

Tyr Leu Gly Ser Leu Val Gln Tyr Trp Gly Leu Glu Leu Lys Arg Ser

785 790 795 800

Ala Ile Ser Leu Leu Asp Thr Leu Ala Ile Ala Val Gly Glu Gly Thr

805 810 815

Asp Arg Ile Leu Glu Phe Val Leu Gly Ile Cys Arg Ala Ile Arg Asn

820 825 830

Ile Pro Thr Arg Ile Arg Gln Gly Phe Glu Thr Ala Leu Leu

835 840 845

<210> SEQ ID NO 223

<211> LENGTH: 846

<212> TYPE: PRT

<213> ORGANISM: Artificial Sequence

<220> FEATURE:

<223> OTHER INFORMATION: Description of Artificial Sequence: Synthetic

polypeptide

<400> SEQUENCE: 223

Met Arg Val Met Gly Ile Gln Arg Asn Tyr Pro Gln Trp Trp Ile Trp

1 5 10 15

Ser Met Leu Gly Phe Trp Met Leu Met Ile Cys Asn Gly Met Trp Val

20 25 30

Thr Val Tyr Tyr Gly Val Pro Val Trp Lys Glu Ala Lys Thr Thr Leu

35 40 45

Phe Cys Ala Ser Asp Ala Lys Ala Tyr Glu Lys Glu Val His Asn Val

50 55 60

Trp Ala Thr His Ala Cys Val Pro Thr Asp Pro Asn Pro Gln Glu Met

65 70 75 80

Val Leu Lys Asn Val Thr Glu Asn Phe Asn Met Trp Lys Asn Asp Met

85 90 95

Val Asp Gln Met His Glu Asp Val Ile Ser Leu Trp Asp Gln Ser Leu

100 105 110

Lys Pro Cys Val Lys Leu Thr Pro Leu Cys Val Thr Leu Asn Cys Thr

115 120 125

Asn Ala Thr Ala Ser Asn Ser Ser Ile Ile Glu Gly Met Lys Asn Cys

130 135 140

Ser Phe Asn Ile Thr Thr Glu Leu Arg Asp Lys Arg Glu Lys Lys Asn

145 150 155 160

Ala Leu Phe Tyr Lys Leu Asp Ile Val Gln Leu Asp Gly Asn Ser Ser

165 170 175

Gln Tyr Arg Leu Ile Asn Cys Asn Thr Ser Val Ile Thr Gln Ala Cys

180 185 190

Pro Lys Val Ser Phe Asp Pro Ile Pro Ile His Tyr Cys Ala Pro Ala

195